网站首页公司简介网站新闻产品目录产品中心下载中心技术文章询价留言联系方式
产品搜索: OCT包埋剂,ALZET微渗泵,EK酶,3MM滤纸 polysciences trlink cygnus crystalchem sysy
 产品目录
 热卖产品
Pranovo Biotech 特约代理
MRC-Holland 中国代理
TimTec LLC 特约代理
Chiron 特约代理
Nova Biomedical 特约代理
International Humic Substances Society 代理
BioLynx Inc. 特约代理
cpspolymers 特约代理
ProteinSimple 特约代理
ChemoTactics,Inc 特约代理
Cambio 特约代理
Advansta, Inc. 特约代理
 联系我们
公司名称:上海起发实验试剂有限公司
电话:021-50724187 021-50724961
手机:15921799099
联系人:杨经理
邮编:201203
邮箱:fige007@163.com
公司网址:www.qfbio.com
 首页>>产品展示>>>>品牌介绍
 产品展示

merck 2012年价格表

点击放大
产品型号:
产品报价:
产品特点:
rPeptide is a biotechnology company providing a range of research products and services, with a focus on products for Alzheimer's and Parkinson's disease research.
  merck 2012年价格表的详细资料:

1.00084.0025 4-Aminohippuric acid for biochemistry 1003
1.00084.0100 4-Aminohippuric acid for biochemistry 3389
1.00126.0100 L-Aspartic acid for biochemistry 418
1.00126.1000 L-Aspartic acid for biochemistry 2943
1.00126.9010 L-Aspartic acid for biochemistry 16284
1.00142.0100 mono-Sodium-L-aspartate-monohydrate for biochemistry 662
1.00142.1000 mono-Sodium-L-aspartate-monohydrate for biochemistry 4199
1.00209.1000 Acrylamide for electrophoresis special quality for molecular biology 4222
1.00289.0025 L-Glutamine for biochemistry 505
1.00289.0100 L-Glutamine for biochemistry 763
1.00289.1000 L-Glutamine for biochemistry 5801
1.00289.9010 L-Glutamine for biochemistry 53004
1.00291.0250 L-Glutamic acid for biochemistry 1168
1.00291.1000 L-Glutamic acid for biochemistry 2591
1.00291.9010 L-Glutamic acid for biochemistry 21874
1.00353.0010 Indole-3-acetic acid LAB 339
1.00353.0100 Indole-3-acetic acid LAB 3389
1.00354.0005 Indole-3-butyric acid LAB 555
1.00354.0025 Indole-3-butyric acid LAB 2759
1.00354.0100 Indole-3-butyric acid LAB 5695
1.00354.0500 Indole-3-butyric acid LAB 38987
1.00382.0250 DL-Malic acid for biochemistry 396
1.00382.1000 DL-Malic acid for biochemistry 950
1.00498.0025 Ficoll® 400 for molecular biology ® = Trademark of Pharmacia, LKB GmbH, Freiburg 2205
1.00498.0250 Ficoll® 400 for molecular biology ® = Trademark of Pharmacia, LKB GmbH, Freiburg 13295
1.00633.1000 Acrylamide ready-to-use solution 40% for electrophoresis 1366
1.00638.1000 Acrylamide-bis ready-to-use solution 40% (37.5:1) for electrophoresis 1774
1.00639.1000 Acrylamide-bis ready-to-use solution 30% (37.5:1) for electrophoresis 1366
1.00640.1000 Acrylamide-bis ready-to-use solution 40% (19:1) for electrophoresis 1260
1.00641.1000 Acrylamide-bis ready-to-use solution 40% (29.1:0.9) for electrophoresis 1429
1.00963.0100 DL-Alanine for biochemistry 382
1.00963.1000 DL-Alanine for biochemistry 1952
1.01007.0025 L-Alanine for biochemistry 382
1.01007.0100 L-Alanine for biochemistry 1003
1.01007.1000 L-Alanine for biochemistry 6103
1.01007.9010 L-Alanine for biochemistry 54601
1.01008.0250 ß-Alanine for biochemistry 382
1.01008.1000 ß-Alanine for biochemistry 1029
1.01193.0001 MagPrep® Silica Particles 924
1.01211.0250 Ammonium sulfate for biochemistry 556
1.01211.1000 Ammonium sulfate for biochemistry 378
1.01211.5000 Ammonium sulfate for biochemistry 1632
1.01211.9050 Ammonium sulfate for biochemistry 7765
1.01235.0050 Agarose for preparative nucleic acid electrophoresis 6954
1.01236.0100 Agarose for analytical nucleic acid electrophoresis 2927
1.01236.0500 Agarose for analytical nucleic acid electrophoresis 7534
1.01252.0100 Starch soluble GR for analysis ISO 582
1.01252.0250 Starch soluble GR for analysis ISO 1065
1.01252.1000 Starch soluble GR for analysis ISO 2719
1.01252.9025 Starch soluble GR for analysis ISO 74636
1.01257.0050 Starch soluble acc. to Zulkowsky GR for analysis 1344
1.01257.0250 Starch soluble acc. to Zulkowsky GR for analysis 4619
1.01257.1000 Starch soluble acc. to Zulkowsky GR for analysis 15231
1.01539.0500 Sodium acetate anhydrous for molecular biology 678
1.01540.0500 Sodium chloride for molecular biology 587
1.01540.5000 Sodium chloride for molecular biology 1505
1.01542.0100 L-Arginine for biochemistry 603
1.01542.1000 L-Arginine for biochemistry 3885
1.01542.9010 L-Arginine for biochemistry 36081
1.01543.0050 L-Arginine monohydrochloride for biochemistry 354
1.01543.0250 L-Arginine monohydrochloride for biochemistry 1393
1.01543.1000 L-Arginine monohydrochloride for biochemistry 4063
1.01543.9010 L-Arginine monohydrochloride for biochemistry 37360
1.01546.0100 N,N'-Methylenebisacrylamide for electrophoresis, special grade for molecular biology 1360
1.01547.0100 Tris(hydroxymethyl)aminomethane hydrochloride for molecular biology 587
1.01547.1000 Tris(hydroxymethyl)aminomethane hydrochloride for molecular biology 3849
1.01548.0100 Cesium chloride for molecular biology 1417
1.01548.0500 Cesium chloride for molecular biology 4776
1.01549.0500 Tris(hydroxymethyl)aminomethane for molecular biology price on request
1.01549.2500 Tris(hydroxymethyl)aminomethane for molecular biology price on request
1.01566.0100 L-Asparagine monohydrate for biochemistry 843
1.01566.1000 L-Asparagine monohydrate for biochemistry 4542
1.01566.9010 L-Asparagine monohydrate for biochemistry 42148
1.01642.0100 MagPrep® TiO2 Particles 1845
1.01642.1000 MagPrep® TiO2 Particles 6795
1.01644.0001 MagPrep® Silica MS 1326
1.01651.0025 Bromelain (from pineapples) 2 mAnson U/mg for biochemistry EC 3.4.22.32 412
1.01651.1000 Bromelain (from pineapples) 2 mAnson U/mg for biochemistry EC 3.4.22.32 8497
1.01701.0005 N6-Benzyladenine for biochemistry 1082
1.01701.0025 N6-Benzyladenine for biochemistry 4382
1.01894.0100 Brij® 35 solution (30% w/w in water) for biochemistry 359
1.01894.1000 Brij® 35 solution (30% w/w in water) for biochemistry 1711
1.01899.0001 MagPrep® Silica HS 1326
1.01910.0025 N,N-Bis(2-hydroxyethyl) glycine (BICINE) buffer substance 888
1.01910.0250 N,N-Bis(2-hydroxyethyl) glycine (BICINE) buffer substance 2416
1.01910.9010 N,N-Bis(2-hydroxyethyl) glycine (BICINE) buffer substance 91960
1.02126.0050 alpha-Cyclodextrine for biochemistry 3247
1.02242.2500 Casein acc. to HAMMARSTEN LAB 12333
1.02243.0001 Ethidium bromide adsorber for decontamination of ethidium bromide from staining solutions 896
1.02244.0100 Casein for biochemistry 1461
1.02307.0001 alpha-Chymotrypsin (from bovine pancreas) cryst. lyophilized 350 U/mg for biochemistry EC 3.4.21.1 1216
1.02307.0005 alpha-Chymotrypsin (from bovine pancreas) cryst. lyophilized 350 U/mg for biochemistry EC 3.4.21.1 4222
1.02321.0005 Cellulase Onozuka R-10 (from Trichoderma viride) 1 U/mg for biochemistry EC 3.2.1.4 1562
1.02321.0025 Cellulase Onozuka R-10 (from Trichoderma viride) 1 U/mg for biochemistry EC 3.2.1.4 6883
1.02352.0025 Cellobiose for biochemistry 2395
1.02383.0250 Calcium chloride dihydrate for molecular biology 429
1.02383.1000 Calcium chloride dihydrate for molecular biology 766
1.02510.0005 MagPrep® P-25 Carboxy 4321
1.02540.0005 MagPrep® P-25 Protein A 3324
1.02550.0005 MagPrep® P-25 Streptavidin 3639
1.02606.0001 Cholinesterase (from horse serum) lyophylized 500 U/vial for biochemistry EC 3.1.1.8 2058
1.02837.0025 L-Cystine for biochemistry 348
1.02837.0100 L-Cystine for biochemistry 688
1.02837.1000 L-Cystine for biochemistry 5677
1.02837.9010 L-Cystine for biochemistry 51728
1.02838.0025 L-Cysteine for biochemistry 379
1.02838.0100 L-Cysteine for biochemistry 946
1.02838.1000 L-Cysteine for biochemistry 5907
1.02838.9010 L-Cysteine for biochemistry 71526
1.02839.0025 L-Cysteine hydrochloride monohydrate for biochemistry 422
1.02839.0100 L-Cysteine hydrochloride monohydrate for biochemistry 679
1.02839.1000 L-Cysteine hydrochloride monohydrate for biochemistry 4879
1.02839.9010 L-Cysteine hydrochloride monohydrate for biochemistry 45023
1.02966.0020 1-Fluoro-2,4-dinitrobenzene for biochemistry 799
1.02966.0100 1-Fluoro-2,4-dinitrobenzene for biochemistry 2892
1.03094.0001 5-Dimethylaminonaphthalene-1-sulfonyl chloride for biochemistry 511
1.03094.0010 5-Dimethylaminonaphthalene-1-sulfonyl chloride for biochemistry 3257
1.03095.0250 di-Sodium hydrogen phosphate anhydrous for molecular biology price on request
1.03095.1000 di-Sodium hydrogen phosphate anhydrous for molecular biology price on request
1.03252.0025 2,2-Bis(hydroxyethyl)-(iminotris)- (hydroxymethyl)-methane BIS-TRIS 497
1.03252.0250 2,2-Bis(hydroxyethyl)-(iminotris)- (hydroxymethyl)-methane BIS-TRIS 3939
1.03256.0010 Cacodylic acid sodium salt trihydrate buffer substance for biochemistry 541
1.03256.0100 Cacodylic acid sodium salt trihydrate buffer substance for biochemistry 2164
1.03291.0001 2,2'-Dinitro-5,5'-dithiodibenzoic acid for biochemistry 511
1.03291.0005 2,2'-Dinitro-5,5'-dithiodibenzoic acid for biochemistry 1402
1.03291.0025 2,2'-Dinitro-5,5'-dithiodibenzoic acid for biochemistry 5375
1.03604.0050 Diastase (from fungi) for biochemistry 1117
1.03740.0002 Hygromycin B solution for biochemistry 4666
1.03984.0005 Folic acid for biochemistry 508
1.03984.0025 Folic acid for biochemistry 1540
1.04007.0250 D(-)-Fructose for biochemistry 352
1.04007.1000 D(-)-Fructose for biochemistry 885
1.04058.0025 D(+)-Galactose for biochemistry 541
1.04058.0100 D(+)-Galactose for biochemistry 1650
1.04074.0500 D(+)-Glucose monohydrate for biochemistry 298
1.04074.1000 D(+)-Glucose monohydrate for biochemistry 468
1.04074.5000 D(+)-Glucose monohydrate for biochemistry 1145
1.04074.9050 D(+)-Glucose monohydrate for biochemistry 7595
1.04114.0002 ß-Glucuronidase/aryl sulfatase (from Helix pomatia) stabilized aqueous solution for biochemistry EC 3.2.1.31 + EC 3.1.6.1 1672
1.04167.0250 Guanidinium thiocyanate for biochemistry 1460
1.04169.0250 Glycine buffer substance for electrophoresis 426
1.04169.1000 Glycine buffer substance for electrophoresis 1322
1.04201.0100 Glycine GR for analysis 303
1.04201.0250 Glycine GR for analysis 454
1.04201.1000 Glycine GR for analysis 1628
1.04201.5000 Glycine GR for analysis 4542
1.04201.9025 Glycine GR for analysis 29535
1.04219.0025 Guanidinium chloride for biochemistry 706
1.04219.0100 Guanidinium chloride for biochemistry 1411
1.04219.0500 Guanidinium chloride for biochemistry 6174
1.04219.9025 Guanidinium chloride for biochemistry 249858
1.04220.0100 Guanidinium chloride LAB 431
1.04220.1000 Guanidinium chloride LAB 2307
1.04220.5000 Guanidinium chloride LAB 9988
1.04220.9010 Guanidinium chloride LAB 15665
1.04220.9025 Guanidinium chloride LAB 61865
1.04233.0010 Glycylglycine buffer substance 518
1.04233.0100 Glycylglycine buffer substance 2395
1.04233.1000 Glycylglycine buffer substance 16179
1.04350.0025 L-Histidine monohydrochloride monohydrate for biochemistry 513
1.04350.0100 L-Histidine monohydrochloride monohydrate for biochemistry 1252
1.04350.0500 L-Histidine monohydrochloride monohydrate for biochemistry 3971
1.04350.9010 L-Histidine monohydrochloride monohydrate for biochemistry 67693
1.04351.0025 L-Histidine for biochemistry 545
1.04351.0100 L-Histidine for biochemistry 1251
1.04351.1000 L-Histidine for biochemistry 9544
1.04351.9010 L-Histidine for biochemistry 87491
1.04506.0010 L-Hydroxyproline for biochemistry 664
1.04506.0100 L-Hydroxyproline for biochemistry 3495
1.04507.0050 myo-Inositol for biochemistry 322
1.04507.0250 myo-Inositol for biochemistry 1440
1.04716.0050 Imidazole buffer substance ACS 562
1.04716.0250 Imidazole buffer substance ACS 1480
1.04716.1000 Imidazole buffer substance ACS 5402
1.04830.0250 Potassium acetate for molecular biology 355
1.04830.1000 Potassium acetate for molecular biology 740
1.05177.0005 Kanamycindisulfate for biochemistry 700
1.05177.0025 Kanamycindisulfate for biochemistry 2310
1.05194.0025 2-Oxoglutaric acid for biochemistry 245
1.05194.0100 2-Oxoglutaric acid for biochemistry 706
1.05194.1000 2-Oxoglutaric acid for biochemistry 4914
1.05194.9010 2-Oxoglutaric acid for biochemistry 65457
1.05206.0050 Creatinine for biochemistry 780
1.05206.0500 Creatinine for biochemistry 5369
1.05360.0025 L-Leucine for biochemistry 434
1.05360.0250 L-Leucine for biochemistry 1597
1.05360.9010 L-Leucine for biochemistry 58752
1.05362.0025 L-Isoleucine for biochemistry 626
1.05362.0100 L-Isoleucine for biochemistry 2058
1.05362.0500 L-Isoleucine for biochemistry 8746
1.05362.9010 L-Isoleucine for biochemistry 182643
1.05388.0025 D(+)-Mannose for biochemistry 568
1.05388.0100 D(+)-Mannose for biochemistry 1810
1.05673.0050 Lithium chloride for molecular biology 705
1.05673.0250 Lithium chloride for molecular biology 1208
1.05700.0100 L-Lysine monohydrochloride for biochemistry 357
1.05700.1000 L-Lysine monohydrochloride for biochemistry 1606
1.05700.9010 L-Lysine monohydrochloride for biochemistry 14690
1.05707.0025 L-Methionine for biochemistry 382
1.05707.0100 L-Methionine for biochemistry 882
1.05707.1000 L-Methionine for biochemistry 4755
1.05707.9010 L-Methionine for biochemistry 44383
1.05912.0025 Maltose monohydrate for biochemistry 947
1.05912.0100 Maltose monohydrate for biochemistry 4414
1.06022.1000 Dodecyl sulfate sodium salt for biochemistry 10% in H2O 808
1.06022.9050 Dodecyl sulfate sodium salt for biochemistry 10% in H2O 24451
1.06023.1000 TAE buffer 10 x pH 8.3 tris-acetate-EDTA buffer 1385
1.06062.1000 N,N'-Methylenebisacrylamide ready-to-use solution "BIS" 2% for electrophoresis 950
1.06126.0025 2-Morpholinoethanesulfonic acid monohydrate buffer substance MES 461
1.06126.0250 2-Morpholinoethanesulfonic acid monohydrate buffer substance MES 2732
1.06126.1000 2-Morpholinoethanesulfonic acid monohydrate buffer substance MES 9136
1.06126.9010 2-Morpholinoethanesulfonic acid monohydrate buffer substance MES 99623
1.06129.0025 3-Morpholinopropane sulfonic acid buffer substance MPS 444
1.06129.0250 3-Morpholinopropane sulfonic acid buffer substance MPS 2823
1.06129.9010 3-Morpholinopropane sulfonic acid buffer substance MPS 109203
1.06174.1000 TAE buffer 50 x pH 8,3 tris-acetate EDTA buffer 1422
1.06177.2500 TBE buffer 10 x pH 8.3 tris-borate-EDTA buffer 1082
1.06186.0100 3-(Cyclohexylamino)-2-hydroxy-1-propanesulfonic acid (CAPSO) Buffer substance 963
1.06186.1000 3-(Cyclohexylamino)-2-hydroxy-1-propanesulfonic acid (CAPSO) Buffer substance 6525
1.06194.0100 Piperazine-1,4-bis(propanesulfonic acid) (PIPPS) buffer substance 1767
1.06194.1000 Piperazine-1,4-bis(propanesulfonic acid) (PIPPS) buffer substance 12123
1.06195.0100 3-(Cyclohexylamino)-1-propanesulfonic acid (CAPS) buffer substance 1138
1.06195.0500 3-(Cyclohexylamino)-1-propanesulfonic acid (CAPS) buffer substance 3761
1.06197.0100 2-Morpholinoethanesulfonic acid sodium salt (MES Na) buffer substance 1068
1.06197.1000 2-Morpholinoethanesulfonic acid sodium salt (MES Na) buffer substance 5598
1.06220.0010 1-Naphthylacetic acid for biochemistry 304
1.06220.0100 1-Naphthylacetic acid for biochemistry 1251
1.06254.0100 Neomycin sulfate for biochemistry 1473
1.06619.0050 Pyruvic acid sodium salt for biochemistry 785
1.06619.0250 Pyruvic acid sodium salt for biochemistry 2455
1.06619.1000 Pyruvic acid sodium salt for biochemistry 9565
1.06817.0100 Nicotinic acid for biochemistry 473
1.06906.0025 L-Ornithine monohydrochloride for biochemistry 320
1.06906.0100 L-Ornithine monohydrochloride for biochemistry 1047
1.06906.1000 L-Ornithine monohydrochloride for biochemistry 7965
1.06906.9010 L-Ornithine monohydrochloride for biochemistry 73120
1.07144.0025 Papain (from Carica papaya) water-soluble 30000 USP-U/mg for biochemistry EC 3.4.22.2 437
1.07185.0100 Pepsin (from porcine gastric mucosa) 0.7 FIP-U/mg for biochemistry EC 3.4.23.1 714
1.07192.0001 Pepsin (from porcine gastric mucosa) cryst. lyophilized 10 FIP-U/mg for biochemistry EC 3.4.23.1 2537
1.07256.0025 L-Phenylalanine for biochemistry 346
1.07256.0100 L-Phenylalanine for biochemistry 1127
1.07256.1000 L-Phenylalanine for biochemistry 8214
1.07256.9010 L-Phenylalanine for biochemistry 75995
1.07257.0025 DL-Phenylalanine for biochemistry 1091
1.07257.0100 DL-Phenylalanine for biochemistry 1987
1.07360.0001 Pimaricin for biochemistry 2030
1.07361.0010 L(+)-Rhamnose monohydrate for biochemistry 626
1.07361.0025 L(+)-Rhamnose monohydrate for biochemistry 1322
1.07393.0010 Proteinase K (from Tritirachium album) solution in Tris/HCl pH 7.5; 0.01 mol/l; 600 mAnson-U/ml; for molecular biology EC 3.4.21.14 1621
1.07419.0050 Raffinose pentahydrate for biochemistry 1393
1.07433.0001 Pronase E (from Streptomyces griseus) 4,000,000 PU/g for biochemistry EC 3.4.24.4 1351
1.07433.0005 Pronase E (from Streptomyces griseus) 4,000,000 PU/g for biochemistry EC 3.4.24.4 6680
1.07434.0010 L-Proline for biochemistry 389
1.07434.0100 L-Proline for biochemistry 1473
1.07434.0500 L-Proline for biochemistry 6582
1.07434.9010 L-Proline for biochemistry 120378
1.07605.0050 D(-)-Ribose for biochemistry 2395
1.07609.0010 Riboflavine for biochemistry 416
1.07609.0100 Riboflavine for biochemistry 2572
1.07660.0250 Lactose monohydrate for biochemistry 491
1.07660.1000 Lactose monohydrate for biochemistry 1128
1.07673.0050 Silane A 174 adhesion promoter 994
1.07687.0250 Sucrose (saccharose) for biochem. Reag. Ph Eur 273
1.07687.1000 Sucrose (saccharose) for biochem. Reag. Ph Eur 484
1.07687.5000 Sucrose (saccharose) for biochem. Reag. Ph Eur 2674
1.07759.0100 D(-)-Sorbitol for biochemistry 720
1.07759.0500 D(-)-Sorbitol for biochemistry 1792
1.07769.0010 L-Serine for biochemistry 290
1.07769.0100 L-Serine for biochemistry 1375
1.07769.1000 L-Serine for biochemistry 11158
1.07769.9010 L-Serine for biochemistry 102498
1.08130.0100 N-Cetyl-N,N,N-trimethylammonium bromide for biochemistry 521
1.08181.0025 Thiamine chloride hydrochloride for biochemistry 345
1.08181.0250 Thiamine chloride hydrochloride for biochemistry 2591
1.08208.1000 Triethylammonium acetate buffer solution for the purification of chemically synthesized oligonucleotides (1 mol/l) pH 7,0 3464
1.08217.0500 Triethylamine buffer substance for biochemistry 1907
1.08238.0500 Glycerol triacetate for biochemistry 1012
1.08283.0050 DL-alpha-Tocopherol for biochemistry 652
1.08320.0025 N-[Tris(hydroxymethyl)methyl]-3-aminopropanesulfonic acid buffer substance TAPS 511
1.08320.0250 N-[Tris(hydroxymethyl)methyl]-3-aminopropanesulfonic acid buffer substance TAPS 2378
1.08337.0250 D(+)-Glucose anhydrous for biochemistry Reag. Ph Eur 571
1.08337.1000 D(+)-Glucose anhydrous for biochemistry Reag. Ph Eur 487
1.08337.5000 D(+)-Glucose anhydrous for biochemistry Reag. Ph Eur 2271
1.08337.9050 D(+)-Glucose anhydrous for biochemistry Reag. Ph Eur 15737
1.08357.0100 Triethanolamine hydrochloride GR for analysis 378
1.08357.1000 Triethanolamine hydrochloride GR for analysis 2927
1.08371.0025 L-Tyrosine for biochemistry 444
1.08371.0100 L-Tyrosine for biochemistry 873
1.08371.1000 L-Tyrosine for biochemistry 4719
1.08371.9010 L-Tyrosine for biochemistry 43744
1.08374.0010 L-Tryptophan for biochemistry 386
1.08374.0100 L-Tryptophan for biochemistry 1792
1.08374.0500 L-Tryptophan for biochemistry 8160
1.08374.9010 L-Tryptophan for biochemistry 146242
1.08379.0250 Triethanolamine GR for analysis 687
1.08379.1000 Triethanolamine GR for analysis 852
1.08382.0100 Tris(hydroxymethyl)aminomethane GR for analysis buffer substance ACS,Reag. Ph Eur 461
1.08382.0250 Tris(hydroxymethyl)aminomethane GR for analysis buffer substance ACS,Reag. Ph Eur 440
1.08382.0500 Tris(hydroxymethyl)aminomethane GR for analysis buffer substance ACS,Reag. Ph Eur 1341
1.08382.1000 Tris(hydroxymethyl)aminomethane GR for analysis buffer substance ACS,Reag. Ph Eur 2348
1.08382.2500 Tris(hydroxymethyl)aminomethane GR for analysis buffer substance ACS,Reag. Ph Eur 4843
1.08382.9025 Tris(hydroxymethyl)aminomethane GR for analysis buffer substance ACS,Reag. Ph Eur 39718
1.08387.0500 Tris(hydroxymethyl)aminomethane TRIS LAB 898
1.08387.2500 Tris(hydroxymethyl)aminomethane TRIS LAB 2874
1.08387.9025 Tris(hydroxymethyl)aminomethane TRIS LAB 16500
1.08411.0010 L-Threonine for biochemistry 329
1.08411.0100 L-Threonine for biochemistry 1266
1.08411.1000 L-Threonine for biochemistry 11442
1.08411.9010 L-Threonine for biochemistry 105052
1.08444.0001 Trypsin  (from  porcine  pancreas)  lyophilized,  purified  by  affinity  chromatography  for  protein  sequence  analysis,  1  package  contains  5  x  50  µg  EC  3.4.21.4 2591
1.08488.0250 Urea for biochemistry 347
1.08488.1000 Urea for biochemistry 918
1.08488.5000 Urea for biochemistry 2324
1.08488.9010 Urea for biochemistry 5396
1.08489.0005 Urease lyophilized 5 U/mg EC 3.5.1.5 2268
1.08489.0025 Urease lyophilized 5 U/mg EC 3.5.1.5 8214
1.08491.0010 EGTA (ethylene glycol-bis(ß-aminoethyl ether)- N,N,N',N'-tetraacetic acid) for molecular biology Titriplex® Titriplex® 512
1.08491.0025 EGTA (ethylene glycol-bis(ß-aminoethyl ether)- N,N,N',N'-tetraacetic acid) for molecular biology Titriplex® Titriplex® 1155
1.08491.0100 EGTA (ethylene glycol-bis(ß-aminoethyl ether)- N,N,N',N'-tetraacetic acid) for molecular biology Titriplex® Titriplex® 4251
1.08495.0025 L-Valine for biochemistry 391
1.08495.0100 L-Valine for biochemistry 724
1.08495.1000 L-Valine for biochemistry 6067
1.08495.9010 L-Valine for biochemistry 55879
1.08543.0250 Ethanol for molecular biology 433
1.08602.0025 N-[Tris(hydroxymethyl)methyl]glycine buffer substance TRICIN 395
1.08602.0250 N-[Tris(hydroxymethyl)methyl]glycine buffer substance TRICIN 2528
1.08602.9010 N-[Tris(hydroxymethyl)methyl]glycine buffer substance TRICIN 128362
1.08605.0050 Triton® X-100 for molecular biology ® = Trademark of Union Carbide 429
1.08689.0025 D(+)-Xylose for biochemistry 493
1.08689.0100 D(+)-Xylose for biochemistry 541
1.08853.0002 MagPrep® Streptavidin Beads 1891
1.08853.0010 MagPrep® Streptavidin Beads 6706
1.08855.0001 Magnetic rack 3044
1.10123.0005 Protamine sulfate for biochemistry 941
1.10123.0025 Protamine sulfate for biochemistry 2856
1.10220.0025 Piperazine-1,4-bis(2-ethanesulfonic acid) buffer substance PIPES 362
1.10220.0250 Piperazine-1,4-bis(2-ethanesulfonic acid) buffer substance PIPES 2296
1.10220.1000 Piperazine-1,4-bis(2-ethanesulfonic acid) buffer substance PIPES 10449
1.10220.9010 Piperazine-1,4-bis(2-ethanesulfonic acid) buffer substance PIPES 49137
1.10590.0005 Xylene cyanol for electrophoresis (C.I. 42135) 1032
1.10695.0025 N-[Tris(hydroxymethyl)-methyl]-2-aminoethanesulfonic acid Buffer substance TES 737
1.10695.0250 N-[Tris(hydroxymethyl)-methyl]-2-aminoethanesulfonic acid Buffer substance TES 5269
1.10695.9010 N-[Tris(hydroxymethyl)-methyl]-2-aminoethanesulfonic acid Buffer substance TES 192221
1.10732.0100 N,N,N',N'-Tetramethyl ethylenediamine (Temed) GR for analysis 541
1.10784.0100 Acrylamide for electrophoresis 466
1.10784.1000 Acrylamide for electrophoresis 2644
1.10789.0001 Titanium(III) chloride solution about 15% (in about 10% hydrochloric acid) for amino acid analysis Reag. Ph Eur 976
1.10897.0050 N,N'-Methylenediacrylamide for electrophoresis 649
1.10897.0100 N,N'-Methylenediacrylamide for electrophoresis 1159
1.11452.0005 Phthaldialdehyde for fluorometry 1027
1.11452.0050 Phthaldialdehyde for fluorometry 8959
1.11474.0001 1,4-Dithiothreitol for biochemistry 378
1.11474.0005 1,4-Dithiothreitol for biochemistry 1081
1.11474.0025 1,4-Dithiothreitol for biochemistry 6543
1.11608.0030 Ethidium bromide (1% solution in water) for electrophoresis 679
1.11615.0001 Ethidium bromide for biochemistry 635
1.11615.0010 Ethidium bromide for biochemistry 3602
1.11662.0001 CHAPS (3-[(3-Cholamidopropyl)-dimethylammonio]-propane- sulfonate) for biochemistry 621
1.11662.0010 CHAPS (3-[(3-Cholamidopropyl)-dimethylammonio]-propane- sulfonate) for biochemistry 5000
1.11685.0250 Starch (from wheat) for biochemistry 431
1.11685.1000 Starch (from wheat) for biochemistry 635
1.11714.0001 3-(4,5-Dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide for biochemistry 896
1.11714.0010 3-(4,5-Dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide for biochemistry 7102
1.12005.0100 tri-Sodium citrate dihydrate for molecular biology 350
1.12005.1000 tri-Sodium citrate dihydrate for molecular biology 971
1.12005.5000 tri-Sodium citrate dihydrate for molecular biology 4094
1.12007.2500 Urea for molecular biology 1995
1.12008.0100 Glycine for molecular biology 328
1.12008.1000 Glycine for molecular biology 1461
1.12011.0100 Glycerol anhydrous for molecular biology 622
1.12011.1000 Glycerol anhydrous for molecular biology 1724
1.12012.0050 Dodecyl sulfate sodium salt for molecular biology 464
1.12012.0500 Dodecyl sulfate sodium salt for molecular biology 2747
1.12013.0001 1,4-Dithiothreitol for molecular biology 490
1.12013.0010 1,4-Dithiothreitol for molecular biology 2257
1.12013.0500 1,4-Dithiothreitol for molecular biology 88305
1.12018.0025 Albumin fraction V (from bovine serum) for biochemistry 1534
1.12018.0100 Albumin fraction V (from bovine serum) for biochemistry 3795
1.12018.0500 Albumin fraction V (from bovine serum) for biochemistry 13295
1.12019.0100 Ammonium sulfate for molecular biology 355
1.12019.1000 Ammonium sulfate for molecular biology 656
1.12019.5000 Ammonium sulfate for molecular biology 3044
1.12027.0100 Formamide for molecular biology 355
1.12027.1000 Formamide for molecular biology 1540
1.12029.0100 EDTA (ethylenedinitrilotetraacetic acid disodium salt dihydrate) for molecular biology Titriplex® 385
1.12029.1000 EDTA (ethylenedinitrilotetraacetic acid disodium salt dihydrate) for molecular biology Titriplex® 2624
1.12031.0100 Guanidinium chloride for molecular biology 709
1.12031.1000 Guanidinium chloride for molecular biology 4584
1.12033.0100 Polyethylene glycol 6000 for molecular biology 416
1.12033.1000 Polyethylene glycol 6000 for molecular biology 1173
1.12040.0250 di-Potassium hydrogen phosphate trihydrate for molecular biology 372
1.12040.1000 di-Potassium hydrogen phosphate trihydrate for molecular biology 945
1.12041.0025 2-[4-(2-Hydroxyethyl)-1-piperazinyl]ethanesulfonic acid for molecular biology HEPES 538
1.12041.0250 2-[4-(2-Hydroxyethyl)-1-piperazinyl]ethanesulfonic acid for molecular biology HEPES 3849
1.12117.0050 L-Citrulline for biochemistry 1331
1.12117.0250 L-Citrulline for biochemistry 5500
1.12233.0100 L-Lysine monohydrate for biochemistry 1446
1.12233.1000 L-Lysine monohydrate for biochemistry 10094
1.12239.0025 Agarose for nuclein acid electrophoresis (range of molecular weight < 1000 bp) 2500
1.12239.0100 Agarose for nuclein acid electrophoresis (range of molecular weight < 1000 bp) 7274
1.12240.0005 Melibiose monohydrate for biochemistry 746
1.12240.0025 Melibiose monohydrate for biochemistry 2395
1.12374.0001 Thrombin (from bovine plasma) 50 NIH-U/mg for biochemistry EC 3.4.21.5 2058
1.12422.0025 N-Acetyl-L-cysteine for biochemistry 523
1.12422.0100 N-Acetyl-L-cysteine for biochemistry 1081
1.12422.1000 N-Acetyl-L-cysteine for biochemistry 9491
1.12422.9010 N-Acetyl-L-cysteine for biochemistry 87170
1.12533.0050 Dodecyl sulfate sodium salt for biochemistry and surfactant tests 661
1.12533.0250 Dodecyl sulfate sodium salt for biochemistry and surfactant tests 2066
1.12533.1000 Dodecyl sulfate sodium salt for biochemistry and surfactant tests 5482
1.12553.0025 Coomassie® Brilliant blue R 250 (C.I. 42660) for electrophoresis Trademark of Imperial Chemical Industries PLC 701
1.13760.0100 Dodecyl sulfate sodium salt LAB 847
1.13760.1000 Dodecyl sulfate sodium salt LAB 5842
1.13760.2500 Dodecyl sulfate sodium salt LAB 7451
1.14275.0010 Ponceau S (C.I. 27195) for electrophoresis 771
1.15118.1000 Ethylene glycol monomethyl ether for amino acid analysis 515
1.15118.2500 Ethylene glycol monomethyl ether for amino acid analysis 1047
1.15118.9026 Ethylene glycol monomethyl ether for amino acid analysis 10937
1.15226.0025 N-(2-Acetamido)-2-aminoethanesulfonic acid buffer substance ACES 657
1.15226.0250 N-(2-Acetamido)-2-aminoethanesulfonic acid buffer substance ACES 5393
1.15226.9010 N-(2-Acetamido)-2-aminoethanesulfonic acid buffer substance ACES 198288
1.15227.0025 N-(2-Acetamido)-iminodiacetic acid buffer substance ADA 831
1.15227.0250 N-(2-Acetamido)-iminodiacetic acid buffer substance ADA 3885
1.15227.9010 N-(2-Acetamido)-iminodiacetic acid buffer substance ADA 230857
1.15228.0025 N,N-Bis(2-hydroxyethyl)-2-aminoethanesulfonic acid buffer substance BES 665
1.15228.0250 N,N-Bis(2-hydroxyethyl)-2-aminoethanesulfonic acid buffer substance BES 3781
1.15228.9010 N,N-Bis(2-hydroxyethyl)-2-aminoethanesulfonic acid buffer substance BES 152947
1.15229.0025 2-(Cyclohexylamino)ethanesulfonic acid buffer substance CHES 821
1.15229.0250 2-(Cyclohexylamino)ethanesulfonic acid buffer substance CHES 5269
1.15230.0025 3-[4-(2-Hydroxyethyl)-1-piperazinyl]-propanesulfonic acid buffer substance HEPPS 877
1.15230.0250 3-[4-(2-Hydroxyethyl)-1-piperazinyl]-propanesulfonic acid buffer substance HEPPS 3229
1.15230.9010 3-[4-(2-Hydroxyethyl)-1-piperazinyl]-propanesulfonic acid buffer substance HEPPS 117824
1.15231.0025 2-[4-(2-Hydroxyethyl)-1-piperazinyl]-ethanesulfonic acid sodium salt buffer substance HEPES-Na 791
1.15231.0250 2-[4-(2-Hydroxyethyl)-1-piperazinyl]-ethanesulfonic acid sodium salt buffer substance HEPES-Na 3690
1.15231.9010 2-[4-(2-Hydroxyethyl)-1-piperazinyl]-ethanesulfonic acid sodium salt buffer substance HEPES-Na 134746
1.15444.0025 Coomassie® Brilliant blue G 250 (C.I. 42655) for electrophoresis 829
1.15640.0001 Aldehyde dehydrogenase (from yeast) lyophilized 100 U/vial for biochemistry EC 1.2.1.5 1345
1.16216.0001 Peroxidase (from horse radish) 10000 U/vial for biochemistry EC 1.11.1.7 897
1.16493.0010 Urease (from jack beans) solution in 50% glycerol, 1000 U/ml for biochemistry EC 3.5.1.5 1331
1.16801.0025 Agarose (medium electroendoosmosis) for electrophoresis 795
1.16801.0250 Agarose (medium electroendoosmosis) for electrophoresis 6351
1.16802.0025 Agarose (low electroendoosmosis) for electrophoresis 808
1.16802.0250 Agarose (low electroendoosmosis) for electrophoresis 6121
1.24511.0005 1,4-Dithioerythritol for biochemistry 1021
1.24511.0025 1,4-Dithioerythritol for biochemistry 4906
1.24540.0050 Dihydronicotinamide adenine dinucleotide phosphate tetrasodium salt for biochemistry NADPH-Na4 1198
1.24540.0250 Dihydronicotinamide adenine dinucleotide phosphate tetrasodium salt for biochemistry NADPH-Na4 5234
1.24541.0001 Nicotinamide adenine dinucleotide phosphate disodium salt for biochemistry NADP-Na2 5032
1.24542.0001 Nicotinamide adenine dinucleotide free acid for biochemistry NAD 708
1.24542.0005 Nicotinamide adenine dinucleotide free acid for biochemistry NAD 2671
1.24542.0025 Nicotinamide adenine dinucleotide free acid for biochemistry NAD 9253
1.24568.0010 Proteinase  K  (from  Tritirachium  album)  chromatographically  purified  lyophilized  30  mAnson-U/mg  for  biochemistry  and  molecular  biology  EC  3.4.21.14 36512
1.24568.0100 Proteinase  K  (from  Tritirachium  album)  chromatographically  purified  lyophilized  30  mAnson-U/mg  for  biochemistry  and  molecular  biology  EC  3.4.21.14 1129
1.24568.0500 Proteinase  K  (from  Tritirachium  album)  chromatographically  purified  lyophilized  30  mAnson-U/mg  for  biochemistry  and  molecular  biology  EC  3.4.21.14 3702
1.24592.0100 Vitamin B12 for biochemistry 447
1.24592.1000 Vitamin B12 for biochemistry 1295
1.24644.0001 Dihydronicotinamide adenine dinucleotide disodium salt for biochemistry NADH-Na2 1621
1.24644.0005 Dihydronicotinamide adenine dinucleotide disodium salt for biochemistry NADH-Na2 5872
1.24802.0500 5-Aminolevulinic acid hydrochloride for biochemistry 1150
1.24802.2500 5-Aminolevulinic acid hydrochloride for biochemistry 3442
1.24807.0001 6-(Furfurylamino)purine for biochemistry 958
1.24807.0250 6-(Furfurylamino)purine for biochemistry 808
1.24839.0100 Pefabloc® SC (4-(2-Aminoethyl)-benzolsulfonylfluorid-hydrochloride) (AEBSF) for biochemistry 970
1.24839.0500 Pefabloc® SC (4-(2-Aminoethyl)-benzolsulfonylfluorid-hydrochloride) (AEBSF) for biochemistry 2856
 BPHHSP-BASE Widescreen® BeadPlex® Human Heat Shock Protein Panel -Base 5990
 BPHHSP-H27 Human Heat Shock Protein 27 832
 BPHHSP-H60 Heat Shock Protein 60 (HSPD1) 832
 BPHHSP-H70 Heat Shock Protein 70 (HSP72, HSPA1A&A1B 832
 BPHHSP-H90 Heat Shock Protein 90 alpha (HSPAA1) 832
 BPHHSP-P27 Phospho-Heat Shock Protein 27 (Ser78/Ser82) 832
03-32-0009-100MG ELASTASE SUBSTRATE VIII, COLORIMETRIC 2123
03-32-1501-25MG Z-PHE-ARG-7-AMIDO-4-METHYLCOUMARIN, HCL 1555
03-32-1501-5MG Z-PHE-ARG-7-AMIDO-4-METHYLCOUMARIN, HCL 519
03-32-5032-1MG MMP-2/MMP-7 SUBSTRATE, FLUOROGENIC 2357
03-32-5033-1MG MMP-2/MMP-7 SUBSTRATE CONTROL 736
03-34-0001-25MG H-GLY-PRO-ARG-PRO-OH 1956
03-34-0001-5MG H-GLY-PRO-ARG-PRO-OH 619
03-34-0002-25MG H-ARG-GLY-ASP-SER-OH 1956
03-34-0027-25MG H-GLY-ARG-GLY-ASP-SER-OH 4229
03-34-0035-25MG H-GLY-ARG-GLY-ASP-SER-PRO-OH 3510
03-34-0035-5MG H-GLY-ARG-GLY-ASP-SER-PRO-OH 936
03-34-0051-100MG CALPEPTIN 11031
03-34-0051-25MG CALPEPTIN 3794
03-34-0051-5MG CALPEPTIN 1354
03-34-0052-25MG H-GLY-ARG-ALA-ASP-SER-PRO-OH 3293
03-34-0052-5MG H-GLY-ARG-ALA-ASP-SER-PRO-OH 870
03-34-0055-25MG H-GLY-ARG-GLY-ASP-THR-PRO-OH 3293
03-34-0055-5MG H-GLY-ARG-GLY-ASP-THR-PRO-OH 853
05-22-0930-100GM B-ENDORPHIN (HUMAN) 1451
05-22-2500-25MG FORMYL-MET-LEU-PHE-OH 520
05-22-3838-1MG BQ-788, SODIUM SALT 3510
05-22-3838-5MG BQ-788, SODIUM SALT 14040
05-23-0050-0.1MG CORTICOTROPIN-REL. FACTOR,HUMAN+RAT 1371
05-23-0050-1MG CORTICOTROPIN-REL. FACTOR,HUMAN+RAT 5432
05-23-0070-1MG A-HELICAL CORTICOTROPIN-REL. FACTOR 9-41 4647
05-23-0101-1MG ANGIOTENSIN II, HUMAN 452
05-23-0101-25MG ANGIOTENSIN II, HUMAN 2591
05-23-0101-5MG ANGIOTENSIN II, HUMAN 652
05-23-0111-5MG [TYR(PO3H2)4]-ANGIOTENSIN II, HUMAN 1311
05-23-0150-1MG [ARG8]-VASOPRESSIN 853
05-23-0150-5MG [ARG8]-VASOPRESSIN 2240
05-23-0300-0.5MG ATRIAL NATRIURETIC FACTOR 1-28, HUMAN 2758
05-23-0300-1MG ATRIAL NATRIURETIC FACTOR 1-28, HUMAN 5182
05-23-0310-0.5MG NATRIURETIC PEPTIDE C-TYPE HUMAN+PORCINE 2006
05-23-0310-1MG NATRIURETIC PEPTIDE C-TYPE HUMAN+PORCINE 3778
05-23-0500-1MG BRADYKININ 285
05-23-0500-25MG BRADYKININ 2123
05-23-0500-5MG BRADYKININ 753
05-23-0600-1MG SUBSTANCE P 569
05-23-0600-25MG SUBSTANCE P 4430
05-23-0600-5MG SUBSTANCE P 2223
05-23-0613-1MG SENKTIDE 1488
05-23-0701-1MG NEUROKININ A 1815
05-23-0751-1MG A-MELANOCYTE-STIMULATING HORMONE 753
05-23-0751-5MG A-MELANOCYTE-STIMULATING HORMONE 3009
05-23-0753-1MG ADRENOCORTICOTROPIC HORMONE 1-24, HUMAN 1956
05-23-0756-5MG [NLE4,D-PHE7]-A-MELANOCYTE-STIM. HORMONE 5432
05-23-0800-1MG DYNORPHIN A 1-13, PORCINE 1287
05-23-0850-1MG SOMATOSTATIN 552
05-23-0850-5MG SOMATOSTATIN 1488
05-23-0930-1MG B-ENDORPHIN, HUMAN 1889
05-23-1200-5MG NEUROTENSIN 2190
05-23-1701-1MG FR-1 1772
05-23-2005-0.5MG NEUROPEPTIDE Y, HUMAN 3778
05-23-2005-1MG NEUROPEPTIDE Y, HUMAN 5867
05-23-2101-0.5MG VASOACTIVE INTESTINAL PEP HUMAN+PORC+RAT 3143
05-23-2101-1MG VASOACTIVE INTESTINAL PEP HUMAN+PORC+RAT 4363
05-23-2102-1MG SECRETIN, HUMAN 5432
05-23-2150-0.1MG PACAP 38, OVINE 1271
05-23-2150-1MG PACAP 38, OVINE 7070
05-23-2151-0.5MG PACAP 27 AMIDE, OVINE 3778
05-23-2301-1MG GASTRIN I, HUMAN 3661
05-23-2401-25MG CALCITONIN, SALMON 7304
05-23-2402-0.5MG CALCITONIN, HUMAN 1371
05-23-2402-1MG CALCITONIN, HUMAN 2474
05-23-2404-0.5MG CALCITONIN GENE-RELATED PEPTIDE-I, HUMAN 3310
05-23-2404-1MG CALCITONIN GENE-RELATED PEPTIDE-I, HUMAN 5650
05-23-2540-0.5MG AMYLIN, HUMAN 2892
05-23-2700-0.1MG GLUCAGON, HUMAN 1137
05-23-2700-0.5MG GLUCAGON, HUMAN 2608
05-23-3703-1MG LAMININ NONAPEPTIDE 1003
05-23-3703-5MG LAMININ NONAPEPTIDE 4028
05-23-3800-0.1MG ENDOTHELIN 1, HUMAN AND PORCINE 1438
05-23-3800-0.5MG ENDOTHELIN 1, HUMAN AND PORCINE 5165
05-23-3800-1MG ENDOTHELIN 1, HUMAN AND PORCINE 8457
05-23-3801-0.1MG ENDOTHELIN 3, HUMAN AND RAT 1488
05-23-3801-0.5MG ENDOTHELIN 3, HUMAN AND RAT 4981
05-23-3813-.1MG SARAFOTOXIN S6C ATRACTASPSIS ENGADDENSIS 1185
05-23-3813-.5MG SARAFOTOXIN S6C ATRACTASPSIS ENGADDENSIS 5332
05-23-3831-1MG BQ-123, SODIUM SALT 2073
05-23-3831-5MG BQ-123, SODIUM SALT 8424
05-23-4904-1MG PROTEIN KINASE C INHIBITOR PEPTIDE 19-31 1822
05-23-4904-5MG PROTEIN KINASE C INHIBITOR PEPTIDE 19-31 6920
05-23-4910-5MG SYNTIDE 2 5566
05-23-5501-1MG PARATHYROID HORMONE 1-34, HUMAN 4028
100050-5MG 1400W 1939
100064-50UG 14-3-3ZETA, GST-FUSION, HU., RECOM 3260
100065-100MG 2-APB 936
100066-25MG 5HPP-33 2507
100068-500UG 17-AAG 3193
100069-500UG 17-DMAG 3410
100071-100UG 14-3-3BETA, GST-FUSION, HUMAN, REC. 6268
100072-100UG 14-3-3GAMMA, GST-FUSION, HUMAN, REC. 6268
100105-10MG A23187, FREE ACID, S. CHARTREUSENSIS 2106
100105-1MG A23187, FREE ACID, S. CHARTREUSENSIS 569
100105-50MG A23187, FREE ACID, S. CHARTREUSENSIS 9749
100105-5MG A23187, FREE ACID, S. CHARTREUSENSIS 1338
100106-10MG A23187, MIXED CALCIUM-MAGNESIUM SALT 2056
100107-1MG A23187, 4-BROMO- 2390
100109-10MG AACOCF3 1605
100110-1GM AAPH 836
100122-10MG A3, HCL 1689
100128-5MG A77 1726 1939
101500-100MG AEBSF, HCL 1254
101500-1GM AEBSF, HCL 9042
101500-500MG AEBSF, HCL 4911
101500-50MG AEBSF, HCL 769
102555-2000U ABL PROTEIN TYROSINE KINASE, RECOMB. 4012
104550-25MG ACA 1555
104850-1SET ACTIN POLYMERIZATION INTERFER AGENTS SET 5967
1063-100MG ACETYLCOENZYME A, TRILITHIUM SALT 7070
1063-10MG ACETYLCOENZYME A, TRILITHIUM SALT 1187
106425-5GM N-ACETYL-L-CYSTEINE 803
107920-200UG ANTI-ACRP30 RABBIT PAB 5282
1079-25GM N-ACETYL-A-D-GLUCOSAMINE 669
108975-100MG LEUPEPTIN, HEMISULFATE 7588
108975-10MG LEUPEPTIN, HEMISULFATE 1338
108975-25MG LEUPEPTIN, HEMISULFATE 2624
108975-50MG LEUPEPTIN, HEMISULFATE 4597
108975-5MG LEUPEPTIN, HEMISULFATE 903
108976-10MG LEUPEPTIN, HEMISULFATE, SYNTHETIC 1116
108976-25MG LEUPEPTIN, HEMISULFATE, SYNTHETIC 2190
110116-1U B1-2,3,4,6-N-AC-GLUCOSAMINIDASE, RECOM 4597
110123-5MG ACETYL-11-KETO-B-BOSWELLIC ACID 3126
110138-1GM N-ACETYLNEURAMINIC ACID, SYNTHETIC 1789
110145-5MG D-ERYTHRO-SPHINGOSINE, N-ACETYL- 1421
110150-5MG N-AC-D-GLUCOSAMINYL-B1,4-N-AC-MURAMYL-L- 3393
110153-2MG N-ACETYLGALACTOSAMINE A1-O-SERINE 5182
110175-1MG ACETYL-PEPSTATIN 2892
112251-1MG A1-ACID GLYCOPROTEIN, HUMAN SERUM 1254
113000-1GM ACRIDINE ORANGE 1137
113200-500UL ANTI-A-ACTIN MOUSE MAB (1A4) 4592
114666-1SET ACTINOMYCIN D, STREPTOMYCES SP. 2649
114666-5MG ACTINOMYCIN D, STREPTOMYCES SP. 1185
114700-5UG ACTIVIN A, HU., RECOM, CHO CELL LINE 5332
114711-25UG FOLLISTATIN 300, HU., RECOM 4779
114798-25MG ACYCLOVIR 1003
114802-250UG ADAAHX3L3VS 3845
114810-5MG ADAMTS-5 INHIBITOR 3271
1152-100GM ADENINE 3393
1152-10GM ADENINE 686
1152-25GM ADENINE 970
115500-50UG ADENOPHOSTIN A, HEXASODIUM SALT 3661
1160-100GM ADENOSINE 2892
1160-10GM ADENOSINE 585
116530-50MG N(6),O(2')-DIOCTANOYL-CAMP, SODIUM SALT 2842
116801-100MG ADENOSINE-3'5'-CYCLIC MONOPHOSPHATE, NA 753
116801-1GM ADENOSINE-3'5'-CYCLIC MONOPHOSPHATE, NA 3510
116802-10UMOL N(6)-BENZOYL-CAMP, SODIUM SALT 2190
116805-500UG PROTEIN KINASE A INHIBITOR 5-24 2307
116811-1KIT CAMP DIRECT IMMUNOASSAY KIT 8131
116812-10MG 8-(4-CHLOROPHENYLTHIO)-CAMP, SODIUM SALT 970
116814-5UMOL CAMPS, RP-ISOMER, TEA SALT 3694
116815-10UMOL CAMPS, SP-ISOMER, TEA SALT 4430
116816-5UMOL CAMPS, 8-BROMO-, RP-ISOMER, SODIUM SALT 8123
116818-5UMOL CAMPS, 8-BROMO-, SP-ISOMER, SODIUM SALT 4881
116819-5UMOL ADENOSINE 3,5-CYCLIC PHOSPHOTHIOATE 8-CL 9026
116820-1ST ANTI-CAMP RABBIT PAB 4513
116825-5UMOL ADENOSINE 3,5-CYCLIC PHOSPHOTHIOATE,2'-O 8407
116833-5UMOL 8-CPT-2'-O-ME-CAMP 5048
116850-25MG ADENYLYL CYCLASE TYPE V INHIBITOR, NKY80 3911
116850-5MG ADENYLYL CYCLASE TYPE V INHIBITOR, NKY80 1104
116880-500U ADENOSINE DEAMINASE, BOVINE INTESTINE 1221
116890-5MG ADENOSINE KINASE INHIBITOR 3427
117105-1GM ADENOSINE 5'-DIPHOSPHATE, POTASSIUM SALT 1087
117110-1MG ADP-RIBOSYLATION FACTOR 6, N-TERM., MYR 1989
1171-1GM ADENOSINE 5'-DIPHOSPHATE, MONOSODIUM 836
1171-5GM ADENOSINE 5'-DIPHOSPHATE, MONOSODIUM 2900
118110-5GM ADENSOINE 5'-MONOPHOSPHATE, DISOD. SALT 1588
118410-10MG ADENOSINE 3'-PHOSPHATE 5'-PHOSPHOSULFAT 9392
118415-1SET ADP-HPD, DIHYDRATE, AMMONIUM 9544
118415-60UG ADP-HPD, DIHYDRATE, AMMONIUM 2608
118500-2MG ATM KINASE INHIBITOR *KU-55933* 1739
118501-5MG ATM/ATR KINASE INHIBITOR *CGK773* 3243
118502-2MG INSOLUTION ATM KINASE INHIBITOR 1622
119101-50UL ANTI-H+,K+-ATPASE A-SUB (1019-34) RB PAB 4841
119102-50UL ANTI-H+,K+-ATPASE, A-SUB (1-17) RB PAB 4841
119107-1KIT ATP ASSAY KIT 5450
119109-1EA LUCIFERIN-LUCIFERASE 953
119113-5MG LUCIFERASE INHIBITOR I 1475
119114-5MG LUCIFERASE INHIBITOR II 1475
119117-100UL ANTI-A1AR (309-326) RABBIT PAB 4636
1191-1GM ADENOSINE 5'-TRIPHOSPHATE, DISODIUM SALT 468
119120-25MG ATP-G-S, TETRALITHIUM SALT 4831
119123-100UL ATP-G-S, SOLUTION, TETRALITHIUM SALT 3243
119125-1GM ADENOSINE 5'-TRIPHOSPHATE, DISODIUM 1304
1191-25GM ADENOSINE 5'-TRIPHOSPHATE, DISODIUM SALT 3393
119127-1SET CAGED ATP, DISODIUM SALT 3360
119127-5MG CAGED ATP, DISODIUM SALT 2207
119134-25MG ADENOSINE 5'-O-(2-THIODIPHOSPHATE), 3LI 7321
1191-50GM ADENOSINE 5'-TRIPHOSPHATE, DISODIUM SALT 6067
1191-5GM ADENOSINE 5'-TRIPHOSPHATE, DISODIUM SALT 936
119186-100U ATP SULFURYLASE, S. CEREVISIAE 5927
120002-25MG ADENYLYL-IMIDODIPHOSPHATE, TETRALITHIUM 3331
121000-1EA Adipogenesis Inducers Panel  5741
121739-25GM ADONITOL 2059
121745-1MG 4-AF DA 1956
121765-2MG AG 825 1789
121767-1MG AG 1024 1254
12177-1KG AGAR 2274
121800-10MG ADVANCED GLYCATION ENDPRODUCT-BSA 3143
121852-100GM AGAROSE, TYPE C 5048
121853-100GM AGAROSE, TYPE I, MOLECULAR BIOLOGY GRADE 3393
121853-500GM AGAROSE, TYPE I, MOLECULAR BIOLOGY GRADE 9845
121937-2ML IMMOBILIZED ANTI-MOUSE IGG 3507
121975-5UG W-AGATOXIN IVA, AGELENOPSIS APERTA 3510
122117-5MG LECTIN, PEANUT, ARACHIS HYPOGAEA 953
122302-5UG W-AGATOXIN TK, AGELENOPSIS APERTA 2324
122640-1KIT PROTEOEXTRACT ALBUMIN REMOVAL KIT 5141
122641-1KIT PROTEOEXTRACT ALBUMIN REMOVAL KIT, MAXI 4590
122642-1KIT PROTEOEXTRACT ALBUMIN/IGG REMOVAL KIT 4935
122643-1KIT PROTEOEXTRACT ALBUMIN/IGG REMOVAL KIT MX 5178
123040-50MG AICA-RIBOSIDE 2006
123041-25MG AICA-RIBOSIDE, 5'-PHOSPHATE 2775
123900-1MG AKTIDE-2T 1672
124001-10T PD ANTI-AKT1 (PTHR308) RABBIT PAB 5104
124002-100UL ANTI-AKT2 RABBIT PAB 4592
124003-1SET PD ANTI-AKT1 (PSER473) MOUSE MAB (11E6) 5833
124005-1MG AKT INHIBITOR 2190
124006-20UG AKT1, HIS-TAG, ACTIVATED, HUMAN, RECOMB. 5950
124007-1KIT AKT ACTIVITY IMMUNOASSAY KIT 9561
124008-1MG AKT INHIBITOR II 4446
124009-1MG AKT INHIBITOR III 4446
124011-1MG AKT INHIBITOR IV 1822
124011-5MG AKT INHIBITOR IV 6435
124012-1MG AKT INHIBITOR V, TRICIRIBINE 2825
124013-2MG AKT INHIBITOR VI, AKT-IN 2641
124014-2MG AKT INHIBITOR VII, TAT-AKT-IN 4948
124015-1MG INSOLUTION(TM) AKT INHIBITOR IV 1822
124017-1MG INSOLUTION AKT INHIBITOR VIII 2574
124018-1MG AKT INHIBITOR VIII, ISOZYME-SELECTIVE 2574
124018-5MG AKT INHIBITOR VIII, ISOZYME-SELECTIVE 2649
124019-5MG AKT INHIBITOR IX, API-59CJ-OME 3427
124020-5MG AKT INHIBITOR X 3861
124021-20UG AKT2, GST-FUSION PROTEIN, HU., RECOM 5382
124022-5UG AKT3, GST-FUSION PROTEIN HU., RECOM 1806
124023-5UG DDR2, GST-FUSION, HUMAN, REC. 5399
124024-10UG TIE2, HIS*TAG, HUMAN, REC. 5399
124026-50UG PCAF HISTONE ACETYL TRANSFERASE, RECOM 6352
124027-1MG MYELIN BASIC PROTEIN, MOUSE 4246
124028-5MG AKT INHIBITOR XI 3343
124029-2MG AKTINHIBITORXII,ISOZYME-SELECTIVE,AKTI-2 3845
124030-2MG AKTINHIBITORXIII,ISOZYME-SELECTIVE,AKTI2 3845
124031-1EA INHIBITORSELECTAKT/PI 3-K/MTORSIGNALINGP 16560
1250-100GM L-ALANINE 903
125510-5MG DIPEPTIDYLPEPTIDASE IV SUB. I, FLUOR. 1739
12657-1GM BSA, FRACTION V, CRYSTALLINE 636
12657-25GM BSA, FRACTION V, CRYSTALLINE 6395
126575-100GM BSA, FRACTION V, FATTY ACID-FREE 6051
126575-10GM BSA, FRACTION V, FATTY ACID-FREE 1120
12657-5GM BSA, FRACTION V, CRYSTALLINE 1789
126579-100GM BSA, FRAC. V, FATTY ACID-POOR, EF 5649
126579-10GM BSA, FRAC. V, FATTY ACID-POOR, EF 936
126584-1ML ANTI-ALBUMIN RABBIT PAB 2194
12659-100GM ALBUMIN, BOVINE SERUM, LOW HEAVY METALS 2507
12659-1KG ALBUMIN, BOVINE SERUM, LOW HEAVY METALS 13748
12659-250GM ALBUMIN, BOVINE SERUM, LOW HEAVY METALS 5073
12659-25GM ALBUMIN, BOVINE SERUM, LOW HEAVY METALS 836
126593-100GM BSA, FRACTION V, RIA AND ELISA GR. 5616
126593-10GM BSA, FRACTION V, RIA AND ELISA GR. 1053
126593-25GM BSA, FRACTION V, RIA AND ELISA GR. 1889
12659-500GM ALBUMIN, BOVINE SERUM, LOW HEAVY METALS 8079
12660-100GM BSA, FRACTION V, MODIFIED COHN, PH 5.2 3143
12660-1KG BSA, FRACTION V, MODIFIED COHN, PH 5.2 16077
126609-100GM BSA, FRAC. V, FATTY ACID, NUC, PROT-FREE 11984
126609-10GM BSA, FRAC. V, FATTY ACID, NUC, PROT-FREE 2023
126609-5GM BSA, FRAC. V, FATTY ACID, NUC, PROT-FREE 1087
126615-25ML BSA, 10% AQUEOUS SOLN, NUCLEASE-FREE 3978
126621-50ML BSA, COHN FRACTION, 30% AQUEOUS SOLN 1438
126625-50ML BSA, 30% AQUEOUS SOLN, STABILIZER-FREE 1507
126626-50ML BSA, 30% AQUEOUS SOLN, PRESERVATIVE-FREE 2006
126654-1GM ALBUMIN, HUMAN SERUM, NON-DENATURED 1956
126658-1GM HSA, FRACTION V, HIGH PURITY 1599
126658-5GM HSA, FRACTION V, HIGH PURITY 5750
12666-100GM HSA, FRACTION V, LOW HEAVY METALS 23315
12666-10GM HSA, FRACTION V, LOW HEAVY METALS 3971
12666-1GM HSA, FRACTION V, LOW HEAVY METALS 602
126674-25MG ALBUMIN, MOUSE 1872
12667-50ML HSA, 30% AQUEOUS SOLN 4023
12668-100GM ALBUMIN, HUMAN SERUM, FRACTION V 20123
12668-10GM ALBUMIN, HUMAN SERUM, FRACTION V 3925
126705-1ML ANTI-ALBUMIN RABBIT PAB 1653
126722-100MG ALBUMIN, RAT 1287
126741-500ML ALCALASE ENZYME, BACILLUS LICHENIFORMIS 1137
126850-2.5MG A1-PDX, HUMAN, RECOMBINANT, E. COLI 7085
126855-100MG ALENDRONATE, SODIUM SALT 2591
126870-1MG ALSTERPAULLONE 1538
126871-1MG ALSTERPAULLONE, 2-CYANOETHYL 2591
126920-25MG ALDH2 AGONIST, ALDA-1 1465
126925-100U ALDEHYDE DEHYDROGENASE, YEAST 1404
127100-10MG ALLOPREGNANOLONE 2591
128125-5MG ALOISINE A 1689
128135-5MG ALOISINE, RP106 1354
129741-1MG A-AMANITIN, AMANITA SP. 3159
129875-1MG AMASTATIN, STREPTOMYCES SP. 1973
129876-100MG AMILORIDE, HCL 803
129935-1MG ACTINOMYCIN D, 7-AMINO- 2190
138000-50MG D-AMINO ACID OXIDASE INHIBITOR 1309
1381-500GM E-AMINO-N-CAPROIC ACID 1722
149101-1GM 1-AMINOCYCLOPROPANE-1-CARBOXYLIC ACID 3343
149101-250MG 1-AMINOCYCLOPROPANE-1-CARBOXYLIC ACID 1120
152224-10ML AEC 1455
152226-50ML AEC SUBSTRATE BUFFER 1066
152228-5MG AEG3482 2739
155305-5MG (S)-A-AMINO-3-OH-5-ME-4-ISOXAZOLEPROPION 2787
164545-10MG 7-AMINO-4-METHYLCOUMARIN 736
164598-50U AMINOPEPTIDASE M, PORCINE KIDNEY 2608
164599-10U AMINOPEPTIDASE N, RAT 3186
164605-10UG AMINOPEPTIDASE N (CD13), HUMAN SERUM 4208
164610-1SET P-AMINOPHENYLMERCURIC ACETATE 4045
164610-700MG P-AMINOPHENYLMERCURIC ACETATE 1053
164640-5MG AMINOPURVALANOL A 2825
165300-5MG L-(+)-2-AMINO-4-PHOSPHONOBUTYRIC ACID 1856
165304-5MG D-(-)-2-AMINO-5-PHOSPHONOPENTANOIC ACID 1672
165350-100MG PARP INHIBITOR I, 3-ABA 652
168306-100ML AMMONIUM ACETATE,5 M,MBG,DEPC-TREATED 803
168320-1KG AMMONIUM CHLORIDE, MB GRADE 853
168320-250GM AMMONIUM CHLORIDE, MB GRADE 405
168355-1KG AMMONIUM SULFATE 1488
168356-1KG AMMONIUM SULFATE, MB GRADE 919
169756-1MG ANTITHROMBIN III, HUMAN PLASMA 3661
171254-25GM AMPICILLIN, SODIUM SALT 2892
171254-5GM AMPICILLIN, SODIUM SALT 853
171255-20ML AMPICILLIN, SODIUM , STERILE, TC GR. 736
171256-5MG AMPK ACTIVATOR D942 2691
171257-10ML AMPICILLIN, SODIUM , STERILE 920
171258-5MG AMPK ACTIVATOR II 3009
171260-10MG AMPK INHIBITOR, COMPOUND C 4646
171260-1MG AMPK INHIBITOR, COMPOUND C 1388
171260-5MG AMPK INHIBITOR, COMPOUND C 4363
171261-1MG INSOLUTION AMPK INHIBITOR, COMPOUND C 1469
171375-100MG AMPHOTERICIN B, STREPTOMYCES SP. 886
171534-1ML ANTI-AMYLASE RABBIT PAB 2721
171536-5UG AMP KINASE (A1/B1/G1), HIS*TAG, HUMAN 8274
171537-100UG ANTI-APP MOUSE MAB (3E9) 4900
171538-5UG AMPK (A1/B1/G2), HIS TAG, HUMAN, REC. 8274
171539-5UG AMPK (A2/B1/G1), HIS TAG, HUMAN, RECOMBI 8274
171587-5MG ABETA42 FIBRILLOGENESIS INHIBITOR II 2507
171588-5MG ABETA42 FIBRILLOGENESIS INHIBITOR III 2507
171590-250UG B-AMYLOID PEPTIDE (1-40, GLN11), HUMAN 3778
171591-250UG BAMYLOID PEPTIDE 1-40, FLUORESCENT LABEL 4179
171593-250UG B-AMYLOID PEPTIDE (1-40), RAT 3778
171596-250UG B-AMYLOID PEPTIDE (1-42), RAT 4363
171598-100UL ANTI-APP, N-TER. (44-63) GOAT PAB 3993
171601-500UG APP BETA-SECRETASE INHIBITOR 2140
171603-100UG ANTI-B-AMYLOID, N-TERM MO MAB (19H11) 4900
171604-100UG ANTI-B-AMYLOID (1-40) MO MAB (5C3) 4900
171605-100UG ANTI-B-AMYLOID (1-40/42), MO MAB (9F1) 4900
171606-100UG ANTI-B-AMYLOID (1-42), MO MAB (8G7) 4900
171607-100UG ANTI-B-AMYLOID (1-43), MO MAB (6G12) 4900
171608-50UL ANTI-B-AMYLOID40 (FCA3340) RABBIT PAB 5833
171609-50UL ANTI-B-AMYLOID42 (FCA3542) RABBIT PAB 7126
171610-50UL ANTI-APP, C-TERMINAL RABBIT PAB 3657
171615-100UL ANTI-B-APLP1, C-TERM (643-653) RB PAB 4801
171616-100UL ANTI-B-APLP2, C-TERM (752-763) RB PAB 4801
171617-100UL ANTI-B-APLP2, FULL-LENGTH RABBIT PAB 4110
172050-10MG ANACARDIC ACID 1471
172060-50MG ANDROGRAPHOLIDE 987
172426-5KU GLUCOAMYLASE, RHIZOPUS SP. 3042
175580-10MG ANGIOGENESIS INHIBITOR 1605
175600-50UG ANGIOGENIN, HUMAN, RECOMBINANT, E. COLI 6067
176002-50UG ANTI-ANGIOPOIETIN-2 RABBIT PAB 4446
176695-10MG ANGELI'S SALT 1287
176708-250UG ANGIOSTATIN K1-3, RECOM, E. COLI 5509
176870-100UG ANGIOTENSINOGEN, HUMAN PLASMA 2123
176871-10UG ACE, HISTAG, HU., RECOM, NSO CEL 5927
176872-10UG ACE-2, HISTAG, HU., RECOM, NSO C 5927
176880-10MG ANISOMYCIN, STREPTOMYCES GRISEOLUS 870
176900-100UG ANTHRAX LETHAL FACTOR, RECOM 4446
176901-1MG ANTHRAX LETHAL FACTOR PROTEASE INHIBITOR 3627
176904-1MG ANTHRAX LETHAL FACTOR SUBSTRATE III, FL 3761
176905-100UG ANTHRAX PROTECTIVE ANTIGEN, RECOM 5768
176908-100UG ANTHRAX PROTECTIVE ANTIGEN, NICK., RECOM 6116
176909-50UG ANTHRAX PROTECTIVE ANTIGEN 63, FITC 8198
178196-100UG A1-ANTICHYMOTRYPSIN, HUMAN PLASMA 1421
178196-1MG A1-ANTICHYMOTRYPSIN, HUMAN PLASMA 8825
178220-10MG ANTIPAIN, HYDROCHLORIDE 1354
178220-5MG ANTIPAIN, HYDROCHLORIDE 723
178221-100UG A2-ANTIPLASMIN, HUMAN PLASMA 1104
178223-10MG ANTIPAIN, DIHYDROCHLORIDE 1371
178251-1MG A1-ANTITRYPSIN, HUMAN PLASMA 1438
178251-5MG A1-ANTITRYPSIN, HUMAN PLASMA 5516
178260-1MG ANTI-A1-ANTITRYPSIN MOUSE MAB (TMF1#4B5) 2940
178270-500UG APAMIN, BEE VENOM 1989
178273-1MG APHIDICOLIN 1438
178276-1MG APICIDIN, FUSARIUM SP. 1605
178276-5MG APICIDIN, FUSARIUM SP. 4196
178278-5MG APIGENIN 652
178281-5MG P-APMSF, HCL 1689
178375-1GM APO-10 1438
178377-1GM APO-12 1438
178385-1GM APOCYNIN 870
178400-1SET APO DETERGENT SET 5950
178422-1ML ANTI-APOLIPOPROTEIN A-I RABBIT PAB 2354
178428-1ML ANTI-APOLIPOPROTEIN C-II RABBIT PAB 1624
178440-100MG FERRITIN, APO-, EQUINE SPLEEN 2992
178444-1MG ANTI-APOLIPOPROTEIN B MOUSE MAB 3627
178446-1MG ANTI-APOLIPOPROTEIN B MOUSE MAB 3569
178452-500UG APOLIPOPROTEIN A-I, HUMAN PLASMA, HDL 2274
178455-500UG APOLIPOPROTEIN A-II, HUMAN PLASMA, HDL 3377
178456-500UG APOLIPOPROTEIN B, HUMAN PLASMA, LDL 3377
178459-100UG APOLIPOPROTEIN C-I, HUMAN PLASMA, VLDL 2808
178461-100UG APOLIPOPROTEIN C-III, HUMAN PLASMA, VLDL 3377
178462-50UG APOLIPOPROTEIN C-II, HUMAN PLASMA, VLDL 3209
178463-1ML ANTI-APOLIPOPROTEIN A-I GOAT PAB 1112
178464-1ML ANTI-APOLIPOPROTEIN A-II GOAT PAB 1404
178467-1ML ANTI-APOLIPOPROTEIN B GOAT PAB 1097
178468-50UG APOLIPOPROTEIN E, HUMAN PLASMA, VLDL 4079
178470-1MG ANTI-APOLIPOPROTEIN A-I MOUSE MAB (6001) 3218
178472-1MG ANTI-APOLIPOPROTEIN A-I MOUSE MAB (513) 3218
178474-1MG ANTI-APOLIPOPROTEIN A-I MOUSE MAB (412) 3218
178479-500UL ANTI-APOLIPOPROTEIN E GOAT PAB 4154
178481-100MG TRANSFERRIN, APO-, LOW ENDOTOXIN GRADE 1572
178481-1GM TRANSFERRIN, APO-, LOW ENDOTOXIN GRADE 10246
178486-1SET APOPTOSIS INDUCER SET 5182
178488-10MG APOPTOSIS INHIBITOR 1789
178489-1SET APOPTOSIS INDUCER SET II 5416
178492-5MG APOPTOSIS ACTIVATOR II 1605
178493-10MG APOPTOSIS ACTIVATOR III, EMBELIN 1739
178494-10MG APOPTOSIS INHIBITOR II, NS3694 1856
178495-100UG APOPTOSIS ACTIVATOR IV, APOPTOLIDIN 3527
178496-5MG APOPTOSIS ACTIVATOR VI, CD437/AHPN 1909
178497-10MG APOPTOSIS ACTIVATOR VII, APOPTOZOLE 1972
17851-1KG AQUACIDE II 1099
17851-5KG AQUACIDE II 4443
1785-1KG AQUACIDE I 1099
17852-1KG AQUACIDE III 1099
17852-5KG AQUACIDE III 4443
1785-5KG AQUACIDE I 4443
178600-200UG ANTI-ARRESTIN (384-397) RABBIT PAB 5661
178605-200UG ANTI-ARRESTIN (347-363), VISUAL RB PAB 4695
178610-50UG ANTI-AQUAPORIN 0 RABBIT PAB 4037
178611-1ST ANTI-AQUAPORIN 1 (243-261) RABBIT PAB 4380
178612-1ST ANTI-AQUAPORIN 2 (254-271) RABBIT PAB 4380
178613-1ST ANTI-AQUAPORIN 3 (275-292) RABBIT PAB 4380
178615-50UG ANTI-AQUAPORIN 5 RABBIT PAB 3920
178670-25GM D(-)ARABINOSE 702
178680-100GM L(+)ARABINOSE 1956
178680-25GM L(+)ARABINOSE 619
181003-1KG L-ARGININE, HCL 4697
181003-250GM L-ARGININE, HCL 1354
181003-50GM L-ARGININE, HCL 753
181198-100MG ARACHIDONIC ACID 1488
181198-1GM ARACHIDONIC ACID 3945
181205-100MG ARACHIDONIC ACID, PORCINE LIVER, SODIUM 2474
181205-1SET ARACHIDONIC ACID, PORCINE LIVER, SODIUM 3861
181305-1MG ARCYRIAFLAVIN A, SYNTHETIC 2207
181402-5UG ASK1, GST-FUSION, HU.,REC.,S. FRUGIPERDA 3377
1820-100GM L-ARGININE, FREE BASE 1053
182015-1MG CYCLO(ARG-GLY-ASP-D-PHE-VAL) 2892
182200-5MG BARK1 INHIBITOR 1973
182300-50MG ARISTOLOCHIC ACID 936
182515-25MG ARP2/3 COMPLEX INHIBITOR I, CK-666 2022
182516-25MG ARP2/3 COMPLEX INHIBITOR II, CK-869 2022
182517-25MG ARP2/3 COMPLEX INHIBITOR I, INACTIVE CON 2022
182518-25MG ARP2/3 COMPLEX INHIBITOR II, INACTIVE CO 2022
182540-1MG AROMATASE INHIBITOR I 1973
182705-10MG AHR ANTAGONIST 2324
182729-1GM ASB-C7BZO 1705
182729-5GM ASB-C7BZO 5733
182730-1GM ASB-C8O-SLASH 1789
182730-5GM ASB-C8O-SLASH 5833
182750-25GM ASB-14 16187
182750-5GM ASB-14 3469
182751-1GM ASB-14-4 1672
182751-5GM ASB-14-4 5533
182753-1SET ASB ZWITTERGENT SET 4697
182755-25GM ASB-16 8240
182755-5GM ASB-16 2390
182800-1MG ASCOMYCIN, STREPTOMYCES HYGROSCOPICUS 2491
1831-1KG L-ASCORBIC ACID, FREE ACID 1588
189361-100MG ATROPINE SULFATE SALT, MONOHYDRATE 736
189400-100MG AURINTRICARBOXYLIC ACID 619
189401-50MG AUROTHIOMALATE 1572
189404-1MG AURORA KINASE INHIBITOR II 1638
189405-1MG AURORA KINASE INHIBITOR III 1572
189406-5MG AURORA KINASE/CDK INHIBITOR *JNJ-7706621 4028
189407-1MG AURORA KINASE/FLT3 INHIBITOR 1584
189480-500UG AUTOCAMTIDE-2 RELATED INHIBITORY PEPTIDE 2223
189482-500UG AUTOCAMTIDE-2 RELATED INHIB PEPTIDE, MYR 2892
189484-1MG AUTOCAMTIDE-2 RELATED INHIB. PEPTIDE II 1973
189485-1MG AUTOCAMTIDE-2 RELATED INHIB. PEPTIDE II 4179
189490-50MG AUTOPHAGY INHIBITOR, 3-MA 920
189497-10MG AUTOPHAGY INDUCER, STF-62247 1309
189724-1000U ASCORBATE OXIDASE, CUCURBITA SP. 1187
189725-100MG AVIDIN, EGG WHITE 5984
189725-10MG AVIDIN, EGG WHITE 1037
189726-2ML AVIDIN, ALKALINE PHOSPHATASE CONJUGATE 2808
189727-1ML AVIDIN, FLUORESCEIN CONJUGATE 2357
189728-2ML AVIDIN, PEROXIDASE CONJUGATE 2524
189730-10MG STREPTAVIDIN 7572
189730-1MG STREPTAVIDIN 1304
189732-2ML STREPTAVIDIN, AL PHOS CONJUGATE 4145
189733-1ML STREPTAVIDIN, PEROXIDASE CONJUGATE 2524
189734-1ML STREPTAVIDIN, FLUORESCEIN CONJUGATE 2357
189737-1ML STREPTAVIDIN, PHYCOERYTHRIN CONJUGATE 3627
189738-1ML STREPTAVIDIN, TEXAS RED CONJ 2524
189739-1ML STREPTAVIDIN AGAROSE SUSPENSION 2666
189742-5ML AVIDIN, AGAROSE CONJUGATE 4196
189825-25MG 5-AZA-2'-DEOXYCYTIDINE 3410
190080-5MG AY 9944 2140
191500-1MG 1-AZAKENPAULLONE 1755
194348-10MG 3'-AZIDO-3'-DEOXYTHYMIDINE 753
194430-1GM ABTS CHROMOPHORE, DIAMMONIUM SALT 619
194434-100ML ABTS CHROMOPHORE 702
194437-1EA ABTS CHROMOPHORE, 20 X 5 MG TABLETS 853
194932-1GM AZOCOLL SUBSTRATE, <50 MESH 1318
194932-5GM AZOCOLL SUBSTRATE, <50 MESH 4646
194933-1GM AZOCOLL SUBSTRATE, >100 MESH 1471
194933-5GM AZOCOLL SUBSTRATE, >100 MESH 5382
194950-1UMOL INSOLUTION AZT, TRIPHOSPHATE, 4LI 3076
194975-25MG B-CELL IMMUNOSUPPRESSANT 2808
195100-100UL ANTI-BACE (26-45) RABBIT PAB 3671
195101-100UL ANTI-BACE (46-65) RABBIT PAB 3671
195102-100UL ANTI-BACE (487-501) RABBIT PAB 3671
195111-100UL ANTI-BACE1, C-TERMINAL (485-501) RB PAB 4870
1951-250KU BACITRACIN 585
195872-100UG ANTI-BAD RABBIT PAB 4680
196000-10UG BAFILOMYCIN A1, STREPTOMYCES GRISEUS 2257
196000-1SET BAFILOMYCIN A1, STREPTOMYCES GRISEUS 4788
196322-10MG BAICALEIN 1438
196350-500UG BAK BH3 FUSION PEPTIDE, CELL-PERMEABLE 3794
196418-1GM BAPTA, TETRASODIUM SALT 2274
196418-250MG BAPTA, TETRASODIUM SALT 769
196418-500MG BAPTA, TETRASODIUM SALT 1304
196419-100MG BAPTA/AM 6485
196419-25MG BAPTA/AM 1872
196440-5MG Batimastat 3319
196805-5MG BAX CHANNEL BLOCKER 1555
196806-10MG Bax Channel Blocker II, iMAC2 1388
196810-5MG BAX-INHIBITING PEPTIDE, V5 1555
196811-5MG BAX-INHIBITING PEPTIDE, NEGATIVE CONTROL 1555
196821-100UL ANTI-BAX (44-62) RABBIT PAB 4680
196870-10MG BAY 11-7082 1304
196871-10MG INSOLUTION(TM) BAY 11-7082 1469
196872-10MG BAY 11-7085 1705
196876-5MG BAY 41-2272 2441
196878-1MG (+/-)-BAY K 8644 903
196878-5MG (+/-)-BAY K 8644 3343
197209-100UG ANTI-BCL-W (16-29) RABBIT PAB 4680
197210-50NMOL BCL-2 ANTISENSE OLIGONUCLEOTIDE, CONTROL 1672
197217-1MG BCL-XL BH4(4-23) (HUMAN), CELL-PERMEABLE 3627
197220-1MG BCL-2 BINDING PEPTIDE, CELL-PERMEABLE 3895
197221-5MG BCR-ABL INHIBITOR 2407
197222-6000U BCL-10, HIS-TAG, HUMAN, WILD TYPE, RECOM 8959
197223-5MG BCR-ABL INHIBITOR II 2257
197225-1MG BCL-2 BINDING PEPTIDE, NEG. CONTROL 3895
197320-2MG BCL-2 CONVERTER,D-NUBCP-9-R8,CELL-PERMEA 4291
197330-5MG BCL-2 INHIBITOR 7484
197331-5MG BCL-2 INHIBITOR II, YC137 2691
197332-10MG BCL-2 INHIBITOR III 1622
197333-5MG BCL-2 INHIBITOR VI, ABT-737 3300
197900-5MG BEC, HYDROCHLORIDE 2708
198800-10UG BEKM-1, {M. EUPEUS}, RECOM, E.COLI 2390
198901-250ML BENZALKONIUM CHLORIDE 3360
199001-25GM BENZAMIDINE, HCL 1302
199001-5GM BENZAMIDINE, HCL 519
200016-5GM N(A)-BENZOYL-L-ARGININE ETHYL ESTER, HCL 569
200100-100MG BENZYL-2-ACETAMIDO-2DEOXY-A-D-GALACTOPYR 2140
200241-1GM 6-BENZYLAMINOPURINE 1167
200274-100MG N(A)-BENZYLOXYCARBONYL-L-LYSINE THIOBENZ 2257
200274-25MG N(A)-BENZYLOXYCARBONYL-L-LYSINE THIOBENZ 753
200484-10MG BESTATIN 2040
200485-5MG BESTATIN METHYL ESTER 2747
200498-5MG BETULINIC ACID 2223
200965-1GM BIG CHAP 2023
201102-100MG BILIRUBIN CONJ., DITAURATE, DISODIUM 1739
201110-500UG BILIGAND KINASE INHIBITOR *ADC-AHX-(D-AR 3310
2011-1GM BILIRUBIN 2691
201125-5MG BINUCLEINE 2 1772
202000-100UG ANTI-BIM (22-40) RABBIT PAB 4227
203110-50MG BIOTIN-XX-HYDRAZIDE 3326
203112-1GM BIOTIN-NHS 8524
203112-250MG BIOTIN-NHS 3728
203112-25MG BIOTIN-NHS 552
203114-100MG BIOTIN-XX-NHS 5248
203114-25MG BIOTIN-XX-NHS 1455
203118-50MG BIOTIN-NHS, WATER-SOLUBLE 1822
203119-10MG INNOLINK BIOTIN 354S 3026
2031-1GM D-(+)-BIOTIN 853
203120-1KIT INNOLINK BIOTIN 354 S KIT 4742
203187-1KIT BIOTIN-X-NHS KIT 3243
203188-25MG BIOTIN-X-NHS 987
203188-50MG BIOTIN-X-NHS 2626
203189-100MG BIOTIN-X-NHS, WATER-SOLUBLE 2223
203189-50MG BIOTIN-X-NHS, WATER-SOLUBLE 1718
203194-1ML BIOTIN, PEROXIDASE CONJUGATE 1722
203195-2MG PROTEIN A, BIOTIN CONJ 1722
203206-1ML ANTI-BIOTIN GT PAB PEROXIDASE CONJUGATE 2721
203290-1MG BISINDOLYLMALEIMIDE I 2056
203290-250UG BISINDOLYLMALEIMIDE I 669
203291-1MG BISINDOLYLMALEIMIDE I, HCL 1989
203291-250UG BISINDOLYLMALEIMIDE I, HCL 669
203292-1MG BISINDOLYLMALEIMIDE II 2708
203293-1ML INSOLUTION(TM) BISINDOLYLMALEIMIDE I 2056
203294-1MG BISINDOLYLMALEIMIDE III, HCL 2641
203294-250UG BISINDOLYLMALEIMIDE III, HCL 970
203297-1MG BISINDOLYLMALEIMIDE IV 2123
203303-1MG BISINDOLYLMALEIMIDE V 2123
203303-250UG BISINDOLYLMALEIMIDE V 819
203325-1GM BMS 2491
203350-25MG BLASTICIDIN S, HCL, S. GRISEOCHROMOGENES 1889
203351-10ML BLASTICIDIN S, STREPTOMYCES SP., 6368
203389-5MG INSOLUTION(TM) BLEBBISTATIN, RACEMIC 2808
203390-5MG BLEBBISTATIN, RACEMIC 2808
203391-1MG (-)-BLEBBISTATIN 2223
203392-1MG (+)-BLEBBISTATIN 1772
203401-10MG BLEOMYCIN SULFATE, S. VERTICILLUS 5833
203408-100MG BLEOCIN, STREPTOMYCES VERTICILLUS, CCT 2558
203408-10MG BLEOCIN, STREPTOMYCES VERTICILLUS, CCT 870
203408-250MG BLEOCIN, STREPTOMYCES VERTICILLUS, CCT 6084
203410-10ML BLEOCIN, STREPTOMYCES VERTICILLUS, STERI 4981
203600-1MG BOHEMINE 1104
203600-5MG BOHEMINE 2725
203637-100UG ANTI-BONE SIALOPROTEIN MOUSE MAB (ID1.2) 4315
203640-100UG ANTI-BMP-2/4, C-TERMINAL RABBIT PAB 4636
203641-2UG BMP-2, HUMAN, RECOMBINANT, E. COLI 2407
203642-2UG BMP-4, HUMAN, RECOMBINANT, E. COLI 2407
203643-2UG BMP-6, HUMAN, RECOMBINANT, E. COLI 2407
203644-20UG BMP-6, HUMAN, RECOMBINANT, MOUSE 9059
203645-2UG BMP-7, HUMAN, RECOMBINANT, E. COLI 2407
203648-100UG BMPR IB/FC CHIMERA, HISTAG, HU., RECOM 7438
203659-1SET BRCA1, WILD-TYPE, HISTAG, HU., RECOM 7441
203661-1MG BRUTON'S TYROSINE KINASE INHIBITOR III 2340
203665-50UL ANTI-BTK MOUSE MAB (10D11) 2896
203667-1KG BORIC ACID, MB GRADE 920
203667-500GM BORIC ACID, MB GRADE 585
203667-5KG BORIC ACID, MB GRADE 3594
203671-500UG BONGKREKIC ACID, TRIAMMONIUM SALT 5115
203675-1MG BOMBESIN, FREE BASE 2023
203678-1MG PROTEIN KINASE G SUBSTRATE, BPDETIDE 2340
203694-5MG BPV(BIPY) 2040
203695-10MG BPV(PHEN) 2457
203696-1MG BPIQ 1872
203697-1MG BPDQ 1872
203701-5MG BPV(HOPIC) 2140
203702-10UG BRAIN DERIVED NEUROTROPHIC FACTOR, RECOM 6268
203702-5UG BRAIN DERIVED NEUROTROPHIC FACTOR, RECOM 4196
203704-1MG BPIQ-II 1872
203705-5MG BPV(PIC) 2073
203715-500UG BQ-610 2591
203724-100ML BRIJ 35 DETERGENT, 30% AQUEOUS SOLUTION 535
203724-1L BRIJ 35 DETERGENT, 30% AQUEOUS SOLUTION 2708
203728-50ML BRIJ 35 DETERGENT, PROTEIN GR., 10% SOLN 1872
203729-1MG (+)-BREFELDIN A, E. BREFELDIANUM 1120
203732-100UG BREVETOXIN PBTX-2, PTYCHODISCUS BREVIS 7373
203734-100UG BREVETOXIN PBTX-3, PTYCHODISCUS BREVIS 6731
203780-25MG 5-BR-4-CL-3-INDOLYL-A-D-GALACTOPYRANOSID 1856
203781-25MG 5-BR-4-CL-3-INDOLYL-A-D-GLUCOPYRANOSIDE 1856
203782-100MG 5-BR-4-CL-3-INDOLYL-B-D-GALACTOPYRANOSID 803
203782-1GM 5-BR-4-CL-3-INDOLYL-B-D-GALACTOPYRANOSID 3209
203782-250MG 5-BR-4-CL-3-INDOLYL-B-D-GALACTOPYRANOSID 1338
203782-5GM 5-BR-4-CL-3-INDOLYL-B-D-GALACTOPYRANOSID 10964
203783-100MG 5-BR-4-CL-3-INDOLYL-B-D-GLUCURONIC ACID 5014
203788-100MG 5-BROMO-4-CHLORO-3-INDOLYLPHOSPHATE 2NA 753
203788-1GM 5-BROMO-4-CHLORO-3-INDOLYLPHOSPHATE 2NA 4196
203790-100ML BCIP/NBT 753
203800-10MG 8-BROMO-CAMP, SODIUM SALT 1020
203806-1GM 5-BROMO-2'-DEOXYURIDINE 1889
203806-5GM 5-BROMO-2'-DEOXYURIDINE 6719
203811-10UG BRYOSTATIN 1 1789
203820-25MG 8-BROMO-CGMP, SODIUM SALT 1739
203860-10MG BTA-1 1856
203881-5MG CR8, (R)-ISOMER 7439
203882-5MG CR8, (S)-ISOMER 7439
203890-5MG CRAC CHANNEL INHIBITOR, BTP2 1989
203895-5MG BTS 1538
203900-10MG BUFALIN 2140
203980-1MG A-BUNGAROTOXIN, BUNGARUS MULTICINCTUS 2190
203984-500MG 2,3-BUTANEDIONE 2-MONOXIME 619
203987-5MG BUTEIN 2691
203988-200UG BUTYROLACTONE I 2507
203989-25GM S-BUTYRYLTHIOCHOLINE IODIDE 2290
203989-5GM S-BUTYRYLTHIOCHOLINE IODIDE 652
203994-5MG N-(N-BUTYL)DEOXYGALACTONOJIRIMYCIN 3126
203995-500MG N-TERT-BUTYL-A-PHENYLNITRONE 1104
203996-10MG N-BUTYLDEOXYNOJIRIMYCIN, HYDROCHLORIDE 3744
204859-1ML ANTI-COMPLEMENT 3A RABBIT PAB 2019
204860-250UG COMPLEMENT C3B, HUMAN 4329
204863-250UG COMPLEMENT IC3B, HUMAN 4914
204869-1ML ANTI-COMPLEMENT 3 GOAT PAB 1317
204870-100UG COMPLEMENT C3D, HUMAN 4914
204873-200UG COMPLEMENT C1, HUMAN 3377
204876-1MG COMPLEMENT C1Q, HUMAN 4112
204878-250UG COMPLEMENT C1R, HU. 4112
204879-250UG COMPLEMENT C1S, HU. 4112
204881-50UG COMPLEMENT C3A, HUMAN 3761
204882-50UG COMPLEMENT C2, HUMAN 4430
204883-1MG COMPLEMENT C1-ESTERASE INHIBITOR, HUMAN 4914
204884-50UG COMPLEMENT C3A DES-ARG, HUMAN 3861
204885-250UG COMPLEMENT C3, HUMAN 3042
204886-250UG COMPLEMENT C4, HUMAN 4914
204887-50UG COMPLEMENT C4A, HUMAN 3861
204888-250UG COMPLEMENT C5, HUMAN 4914
204889-1ML ANTI-COMPLEMENT 5A RABBIT PAB 3437
204890-250UG COMPLEMENT C6, HUMAN 4597
204894-1ML ANTI-COMPLEMENT 4 GOAT PAB 1317
204896-250UG COMPLEMENT C8, HUMAN 4814
204897-250UG COMPLEMENT C4B, HUMAN 4112
204902-30UG COMPLEMENT C5A DES-ARG, HUMAN 4814
204903-1MG ANTI-COMPLEMENT 5B-9 RABBIT PAB 3510
204906-50UG COMPLEMENT C5B,6 COMPLEX, HUMAN 4112
204910-250UG COMPLEMENT C9, HUMAN 6248
204912-1ML ANTI-COMPLEMENT 9 GOAT PAB 1317
205528-1GM C12E8 2792
205530-1MG CA-074 2725
205531-1MG CA-074 ME 2808
205532-1SET C12E8, PROTEIN GR DETERGENT, 10% SOLN 3544
205534-1SET C12E9, PROTEIN GRADE DETERGENT, 10% SOLN 3544
205535-25MG CA 1001 3076
205541-100GM CACODYLIC ACID, SODIUM SALT 3009
205546-500MG CAFFEIC ACID 903
205548-500GM CAFFEINE 1338
205601-100UG ANTI-E-CADHERIN MOUSE MAB (HECD-1) 4797
205602-100UG ANTI-E-CADHERIN MOUSE MAB (SHE78-7) 4797
205603-100UG ANTI-E-CADHERIN (ECCD-1) RT MAB (ECCD-1) 5661
205604-100UG ANTI-E-CADHERIN (ECCD-2) RT MAB (ECCD-2) 5661
205605-100UG ANTI-N-CADHERIN RAT MAB (NCD-2) 4739
205606-1SET ANTI-N-CADHERIN (808-827) RABBIT PAB 5844
205610-100UG ANTI-M-CADHERIN, MOUSE (MOUSE) 4900
205805-250MG CARBENICILLIN, DISODIUM SALT 619
206550-50ML CALBIOSORB ADSORBENT 2354
206552-1ST CALBIOSORB ADSORBENT, PREPACKED COLUMNS 3035
206700-1MG CALCEIN-AM 2725
207000-250UG CALCINEURIN AUTOINHIBITORY PEPTIDE 1806
207001-1MG CALCINEURIN AUTOINHIBITORY PEPTIDE, CELL 3143
207002-100UL ANTI-CAIN RABBIT PAB 4446
207005-1KIT CALCINEURIN ASSAY KIT, COLORIMETRIC 6774
207007-1KTT CALCINEURIN CELLULAR ACTIVITY ASSAY KIT 6243
207008-500UG CALCINEURIN SUBSTRATE 2608
208290-1KG CALCIUM CHLORIDE, DIHYDRATE 1304
208291-250GM CALCIUM CHLORIDE, DIHYDRATE, MB GRADE 435
208292-25MG CALCIUM ENTRY BLOCKER 1471
208665-10MG CALMIDAZOLIUM CHLORIDE 1789
208670-50UG CALMODULIN, HIS*TAG FUSION 1455
208690-1MG CALMODULIN, BOVINE BRAIN 3962
208690-5MG CALMODULIN, BOVINE BRAIN 16630
208693-200UL ANTI-CALMODULIN (AB-1) MOUSE MAB (2D1) 4666
208694-1MG CALMODULIN, BOVINE BRAIN, HIGH PURITY 2390
208694-5MG CALMODULIN, BOVINE BRAIN, HIGH PURITY 7856
208696-200UL ANTI-CALMODULIN (AB-2) MOUSE MAB (6D4) 4666
208697-50UG CALMODULIN, BIOTINYLATED, BOVINE BRAIN 3794
208698-500UG CALMODULIN, HUMAN BRAIN 3995
208699-1MG CA2+/CALMODULIN KINASE II SUBSTRATE 1287
208702-1ML CALMODULIN, IMMOBILIZED, BOVINE BRAIN 3594
208703-50UG ANTI-CAMK II, N-TERM (7-20) RABBIT PAB 4247
208706-5000U CA2+/CAMK II, A-SUB., RAT, RECOM 3878
208707-1UG CA2+/CALMODULIN KINASE II, RAT BRAIN 7906
208707-500NG CA2+/CALMODULIN KINASE II, RAT BRAIN 4663
208709-100UG ANTI-CAMK IV, C-TERM (465-474) RB PAB 4680
208710-500UG [ALA286]-CA2+/CAMK II INHIBITOR 281-301 3861
208711-500UG CA2+/CAMK II INHIBITOR 281-309 2157
208712-1MG CALPAIN-1, PORCINE ERYTHROCYTES 9281
208713-500UG CALPAIN-1, HUMAN ERYTHROCYTES 7653
208715-1MG CALPAIN-2, PORCINE KIDNEY 11041
208715-500UG CALPAIN-2, PORCINE KIDNEY 4114
208718-1MG CALPAIN-2, RAT, RECOMB., HIGH PURITY 7254
208718-250UG CALPAIN-2, RAT, RECOMB., HIGH PURITY 2875
208719-25MG ALLN 3310
208719-5MG ALLN 1187
208721-25MG ALLM 3276
208722-25MG CALPAIN INHIBITOR III 2290
208724-1MG CALPAIN INHIBITOR IV 3544
208725-100UG CALPHOSTIN C, C. CLADOSPORIOIDES 2842
208725-50UG CALPHOSTIN C, C. CLADOSPORIOIDES 1555
208726-1MG CALPAIN INHIBITOR V 3544
208727-100UL ANTI-CALPAIN 1, DOM II, MO MAB (2H2A7C2) 4666
208728-100UL ANTI-CALPAIN-1, DOMIII MO MAB (9A4H8D3) 4666
208729-100UL ANTI-CALPAIN-2 DM III/IV MO MAB (107-82) 4666
208730-100UG ANTI-CALPAIN 1/2, SM SUB MO MAB (28F3) 4095
208731-25MG CALPAIN SUBSTRATE II, FLUOROGENIC 1455
208733-1SET CALPAIN INHIBITOR SET 6268
208734-1MG CALMODULIN BINDING DOMAIN 2056
208735-500UG CALMODULIN INHIBITORY PEPTIDE 2106
208736-500UG CALMODULIN INHIBITORY PEPTIDE, CONTROL 2106
208743-1MG CALPAIN INHIBITOR XI 1605
208743-5MG CALPAIN INHIBITOR XI 5566
208744-1MG CALPAIN INHIBITOR XII 1555
208745-1MG CALPAIN INHIBITOR VI 936
208745-5MG CALPAIN INHIBITOR VI 3326
208748-2MG CALPAIN-1 SUBSTRATE, FLUOROGENIC 3143
208750-5MG INSOLUTION(TM) ALLN 1337
208771-1MG CALPAIN SUBSTRATE-III, FLUOROGENIC 3761
208772-1MG CALPAIN-1 SUBSTRATE II, FLUOROGENIC 3477
208773-1MG CALPAINSUBSTRATEIV,CELL-PERMEABLE,FLUORO 2516
208775-100MG CAMKP INHIBITOR 1505
208780-100UG CALMODULIN, BIOTINYLATED, PORCINE BRAIN 3694
208781-100UG CALMODULIN, PORCINE, RHODAMINE 3460
208782-1MG CALMODULIN-SH, WHEAT GERM 3460
208783-1MG CALMODULIN, PORCINE BRAIN 3109
208851-10UG CALYCULIN A, DISCODERMIA CALYX 2324
208880-50UL ANTI-CALNEXIN, C-TERM (575-593) RB PAB 4124
208882-50UL ANTI-CALNEXIN, N-TERMINAL (50-68) RB PAB 4066
208900-1MG CALPASTATIN, HUMAN, RECOMBINANT 3310
208902-500UG CALPASTATIN PEPTIDE 2775
208903-100UL ANTI-CALPASTATIN DM IV MO MAB (1F7E3D10) 4666
208904-500UG CALPASTATIN PEPTIDE, NEGATIVE CONTROL 2407
208905-100UG ANTI-CALPASTATIN MOUSE MAB (CSL1-5) 4943
208910-50UL ANTI-CALRETICULIN (405-417) RABBIT PAB 3510
208912-50UG ANTI-CALRETICULIN MOUSE MAB (FMC75) 4066
208920-1MG CAMK IINTIDE 2893
208921-1MG CAMK IINTIDE, MYRISTOYLATED 2190
208922-5MG CAMKII INHIBITOR, CK59 3009
208925-50MG CAMPTOTHECIN, CAMPTOTHECA ACUMINATA 1137
209550-100UL ANTI-CANNABINOID RECEPTOR CB1 RABBIT PAB 4695
209552-100UL ANTI-CANNABINOID RECEPTOR CB2 RABBIT PAB 4636
210150-10MG CANTHARIDIC ACID 1187
211200-25MG CAPE 1856
211274-100MG (E)-CAPSAICIN 1137
211280-10MG CAPSAZEPINE 4246
211875-1GM CAPTOPRIL 819
212385-100MG CARBACHOL 786
212402-1MG CARBACYCLIN 4012
215911-250MG CARBONYL CYANIDE M-CHLOROPHENYLHYDRAZONE 1371
215921-500MG CHLORPROMAZINE, HCL 1053
216100-25MG CARBOPLATIN 1455
216201-2MG CARBOXYATRACTYLOSIDE, POTASSIUM SALT, XA 2257
216201-5MG CARBOXYATRACTYLOSIDE, POTASSIUM SALT, 4262
216254-1MG BCECF/AM 1856
216275-50MG 5-CFDA 1254
216407-200UG ANTI-CANNABINOID RECEPTOR CB2 RABBIT PAB 4709
217274-250GM CARBOXYMETHYLCELLULOSE, NA, HIGH VISC. 619
217277-1KG CARBOXYMETHYLCELLULOSE, NA, LOW VISC. 2182
217277-250GM CARBOXYMETHYLCELLULOSE, NA, LOW VISC. 753
217356-250IU CARBOXYPEPTIDASE B, PORCINE PANCREAS 1185
217372-20UG CARBOXYPEPTIDASE Y, EXCISION GR., YEAST 3256
217386-10MG CARBOXY-PTIO, SODIUM SALT 1856
217460-5MG CARDIOGENOL C 2741
217504-1MG CARDIOTOXIN 9478
217505-250MG CBP-CREB Interaction Inhibitor 1348
217538-1GM B-CAROTENE 736
217570-100UG ANTI-CD3 MOUSE MAB (UCHT1) 2062
217575-100UG ANTI-CD4 MOUSE MAB (QS4120) 2838
217577-120T ANTI-CD4 MO MAB (QS4120) FITC CONJUGATE 3262
217580-100UG ANTI-CD8 MOUSE MAB (UCHT4) 2838
217588-25UG CD40-FC FUSION PROTEIN, HU., RECOM, CHO 6669
217590-100UG ANTI-CD40 MOUSE MAB (EA-5) 3452
217594-100UL ANTI-CD44 RAT MAB (A020) 5661
217595-100UG ANTI-CD40L MOUSE MAB (24-31) 4534
217597-120T ANTI-CD40L MO MAB (24-31) FITC CONJUGATE 4943
217599-100UL ANTI-CD44V3 RABBIT PAB 5017
217600-100UG ANTI-CD49D MOUSE MAB (BU49) 3262
217602-120T ANTI-CD49D MO MAB (BU49) FITC CONJUGATE 4066
217604-100UL ANTI-CD44V6 RABBIT PAB 4943
217605-100UG ANTI-CD54 MOUSE MAB (15.2) 3408
217614-20UG PTPASE CD45, HUMAN, RECOMB. 5432
217620-100UG ANTI-CD64 MOUSE MAB (10.1) 3452
217637-120T ANTI-CD106 MO MAB (1.G11B1) FITC CONJ. 4900
217640-100UG ANTI-CD11A MOUSE MAB (38) 3335
217642-100UG ANTI-CD11B MOUSE MAB (ICRF44) 3232
217648-100UG ANTI-CD29 MOUSE MAB (4B7R) 3744
217657-100UG ANTI-CD49F MOUSE MAB (BQ16) 3744
217660-100UG ANTI-CD18, HUMAN (MOAB) 3262
217669-100UG ANTI-CD28 MOUSE MAB (ANC28.1/5D10) 3788
217677-100UG ANTI-CD54 MOUSE MAB (8.4A6) 4241
217685-100UG ANTI-CD44V10 RABBIT PAB 4826
217691-5MG CDC25 PHOSPHATASE INHIBITOR I, BN82002 1689
217692-5MG CDC25 PHOSPHATASE INHIBITOR II 2641
217695-5MG CDK1 INHIBITOR 1872
217696-5MG CDK1 INHIBITOR, CGP74514A 3129
217697-1MG CDK1 INHIBITOR III 1555
217697-5MG CDK1 INHIBITOR III 5566
217699-5MG CDK1 INHIBITOR IV, RO-3306 3393
217705-500UG CDK1 SUBSTRATE II 1555
217707-5MG CDC7/CDK9 INHIBITOR 3092
217713-1MG CDK1/2 INHIBITOR II, NU6102 1053
217713-5MG CDK1/2 INHIBITOR II, NU6102 2591
217714-1MG CDK1/2 INHIBITOR III 1638
217720-5MG CDK1/5 INHIBITOR 2207
217850-100UG ANTI-CD69 MOUSE MAB (HP-4B3) 4212
217952-120T ANTI-CD95L MO MAB (ALF-2.1A) FITC CONJ. 3978
218150-100UG ANTI-CD117 MOUSE MAB (57A5) 4212
218200-1UG CARDIOTROPHIN-1, HU., RECOM 2106
218680-100GM CASEIN, BOVINE MILK 1538
218680-25GM CASEIN, BOVINE MILK 585
218682-100GM CASEIN, BOVINE MILK 1070
218682-500GM CASEIN, BOVINE MILK 2491
218683-50UG CASEIN-ALPHA, HIS*TAG FUSION 2407
218693-15MG PROTEASE SUBSTRATE 8085
218696-1MG CASEIN KINASE I INHIBITOR, D4476 2324
218697-10MG CASEIN KINASE II INHIBITOR I (TBB) 1421
218701-10KU CASEIN KINASE II, HUMAN, RECOMB. 3878
218703-100UG ANTI-CSK II, A-SUB MO MAB (1AD9) 4241
218704-10MIU CASEIN KINASE II, A-SUBUNIT, RECOM 4379
218705-1MG INSOLUTION CKI INHIBITOR, D4476 2324
218708-5MG INSOLUTION CKII INHIBITOR I TBB 987
218709-10UG CASEIN KINASE II, ALPHA 2, HU., RECOM 2875
218710-5MG CASEIN KINASE II INHIBITOR III, TBCA 2140
218712-50UG ANTI-CSK II B-SUB MO MAB (6D5) 4300
218713-5MG KERATINOCYTE DIFFERENTIATION INDUCER 3009
218714-5MG CASEIN KINASE II INHIBITOR IV 2250
218717-50MG CASEIN KINASE II INHIBITORV,QUINALIZARIN 1256
218718-10MG CASEIN KINASE II INHIBITOR VI, TMCB 1242
218720-3000U CASPASE-4, HUMAN, RECOMBINANT, E. COLI 6051
218721-5MG CASPASE SUBSTRATE I, FLUOROGENIC 4246
218725-3000U CASPASE-5, HUMAN, RECOMBINANT, E. COLI 6051
218728-1MG CASPASE-9 INHIBITOR III 1605
218729-1MG CASPASE INHIBITOR VIII 1839
218730-500UG CASEIN KINASE I SUBSTRATE 2928
218731-1MG CASEIN KINASE II SUBSTRATE 3042
218735-1MG CASPASE INHIBITOR II 1221
218739-5MG CASPASE-1 SUBSTRATE X, FLUOROGENIC 2491
218740-1MG CASPASE-2 SUBSTRATE I, FLUOROGENIC 1137
218740-5MG CASPASE-2 SUBSTRATE I, FLUOROGENIC 3260
218742-1MG CASPASE INHIBITOR I, BIOTIN CONJUGATE 7170
218744-1MG CASPASE-2 INHIBITOR I 5950
218744-250UG CASPASE-2 INHIBITOR I 2123
218745-1MG CASPASE INHIBITOR III 2775
218745-250UG CASPASE INHIBITOR III 1087
218746-1MG CASPASE-1 INHIBITOR VI 5081
218746-250UG CASPASE-1 INHIBITOR VI 1705
218750-1MG CASPASE-3 INHIBITOR III 1237
218750-5MG CASPASE-3 INHIBITOR III 4847
218751-1MG CASPASE-3 SUBSTRATE V, FLUOROGENIC 5666
218753-1MG CASPASE-5 INHIBITOR I 5934
218753-250UG CASPASE-5 INHIBITOR I 2106
218754-5MG CASPASE-5 SUBSTRATE II, FLUOROGENIC 5248
218755-1MG CASPASE-4 INHIBITOR I 1137
218757-1MG CASPASE-6 INHIBITOR I 7050
218757-250UG CASPASE-6 INHIBITOR I 1722
218759-1MG CASPASE-8 INHIBITOR II 4911
218759-250UG CASPASE-8 INHIBITOR II 1655
218761-1MG CASPASE-9 INHIBITOR I 5566
218761-250UG CASPASE-9 INHIBITOR I 2190
218763-5MG CASPASE-6 SUBSTRATE III, FLUOROGENIC 3243
218765-1MG CASPASE-9 SUBSTRATE I, FLUOROGENIC 1555
218765-5MG CASPASE-9 SUBSTRATE I, FLUOROGENIC 5248
218766-1MG CASPASE-4 INHIBITOR I, CELL-PERMEABLE 3076
218767-1MG CASPASE-6 INHIBITOR II, CELL-PERMEABLE 3159
218769-3000U CASPASE-8, HUMAN, RECOMBINANT, E. COLI 6602
218770-1KIT CASPASE-8 ASSAY KIT 9084
218772-1SET CASPASE INHIBITOR SET II 11215
218773-1MG CASPASE-8 INHIBITOR I, CELL-PERMEABLE 3276
218774-100UG ANTI-CASPASE-6 RABBIT PAB 4695
218775-1MG CASTANOSPERMINE, CASTANOSPERMUM AUSTRALE 719
218776-1MG CASPASE-9 INHIBITOR II, CELL PERMEABLE 3159
218783-3000U CASPASE-1, HUMAN, RECOM. 6134
218785-3000U CASPASE-10, HUMAN, RECOMB. 6134
218790-1KIT CASPASE-1 ASSAY KIT, COLORIMETRIC 8827
218791-1KIT CASPASE-1 ASSAY KIT, FLUOROMETRIC 8586
218792-1KIT CASPASE-2 ASSAY KIT, COLORIMETRIC 9599
218793-1KIT CASPASE-2 ASSAY KIT, FLUOROMETRIC 8827
218794-100UG ANTI-CASPASE-9 RABBIT PAB 4987
218799-100U CASPASE-6, HUMAN, RECOMBINANT, E. COLI 6001
218800-100U CASPASE-7, HUMAN, RECOMBINANT, E. COLI 5282
218802-1KIT CASPASE-6 ASSAY KIT, COLORIMETRIC 8725
218804-1KIT CASPASE-5 ASSAY KIT, COLORIMETRIC 9599
218805-5MG CASPASE-9 SUBSTRATE II, COLORIMETRIC 2223
218806-1SET CASPASE INHIBITOR SET III 10814
218807-100U CASPASE-9, HUMAN, RECOMBINANT, E. COLI 6452
218808-1SET CASPASE SUBSTRATE SET III, COLORIMETRIC 10898
218809-1SET CASPASE SUBSTRATE SET IV, FLUOROGENIC 10898
218812-1SET CASPASE FAMILY ENZYME SET I, RECOM 15427
218813-100U CASPASE-2, HUMAN, RECOMBINANT 6602
218820-5MG CASPASE-2 SUBSTRATE IV, COLORIMETRIC 3009
218824-1KIT CASPASE-9 ASSAY KIT, COLORIMETRIC 8930
218825-1SET CASPASE INHIBITOR SET IV 6268
218826-1MG CASPASE-3/7 INHIBITOR I 1789
218828-500UG CASPASE-1 SUBSTRATE XV, CELL-PERM, FLUOR 3092
218829-1MG CASPASE-3 SUBSTRATE IX, FLUOROGENIC 2875
218830-1MG CASPASE INHIBITOR II, CELL-PERMEABLE 3059
218832-1MG CASPASE-3/7 INHIBITOR II 1689
218840-250UG INSOLUTION(TM) CASPASE-8 INHIBITOR II 1705
218841-250UG INSOLUTION(TM) CASPASE-9 INHIBITOR I 2190
219001-5MU CATALASE, BOVINE LIVER 1003
219002-1MG CASPASE-3 INHIBITOR V 4597
219007-1MG CASPASE INHIBITOR VI 3276
219007-250UG CASPASE INHIBITOR VI 1187
219008-1MG CATALASE, HUMAN ERYTHROCYTES 1906
219010-1ML ANTI-CATALASE RABBIT PAB 1551
219011-1MG INSOLUTION(TM) CASPASE INHIBITOR VI 3510
219012-10MG CASPASE-3 INHIBITOR VII 2383
219013-10MG CASPASE-3 INHIBITOR VIII 1972
219261-100KU CATALASE, ASPERGILLUS NIGER 836
219265-1KIT CATALASE ASSAY KIT 7614
219330-10MG BETA-CATENIN/TCF INHIBITOR, FH535 2336
219343-25UG CATHEPSIN S, HU., RECOM 4045
219344-25UG CATHEPSIN S, HUMAN SPLEEN 4697
219346-1KIT CATHEPSIN B DETECTION KIT 6264
219347-1KIT CATHEPSIN K DETECTION KIT 5950
219349-100UG ANTI-B-CATENIN, DEPHOSPHO MO MAB (7A7) 4943
219350-1SET ANTI-B-CATENIN DEPHOSPHO MOUSE MAB (8E4) 4900
219353-1SET ANTI-B-CATENIN (CORE) MOUSE MAB (9G10) 4739
219356-1SET ANTI-B-CATENIN, C-TERMINAL MO MAB (10H8) 4739
219357-100UG ANTI-B-CATENIN N-TERMINAL MO MAB (7D11) 4247
219358-1ML ANTI-CATHEPSIN G RABBIT PAB 1712
219360-1MG CATHEPSIN D/E SUBSTRATE, FLUOROGENIC 3544
219361-1ML ANTI-CATHEPSIN D RABBIT PAB 4680
219362-50UG CATHEPSIN B, HUMAN LIVER 4797
219364-5U CATHEPSIN B, HUMAN LIVER 2858
219365-100UG COAGULATION FACTOR V, HUMAN PLASMA 9677
219366-10U CATHEPSIN B, BOVINE SPLEEN 2563
219367-10UG COAGULATION FACTOR VII, HUMAN PLASMA 2240
219368-25UG CARCINOEMBRYONIC ANTIGEN, HUMAN TUMOR 2741
219369-100UG CARCINOEMBRYONIC ANTIGEN, C. ADENOCARCIN 5666
219370-10UG COAGULATION FACTOR VIIA, HUMAN PLASMA 5382
219372-1MG CATHEPSIN G INHIBITOR I 2806
219373-100MIU CATHEPSIN G, HUMAN NEUTROPHIL 2123
219374-100GM CTAB, MB GRADE 736
219377-5MG CATHEPSIN K INHIBITOR I 3647
219379-1MG CATHEPSIN K INHIBITOR II 1789
219380-2GM CEFOTAXIME, SODIUM SALT 3243
219381-1MG CATHEPSIN K INHIBITOR III 2892
219383-100UG ANTI-CAVEOLIN-2 RABBIT PAB 4636
219384-100UL ANTI-CATHEPSIN S RABBIT PAB 2808
219385-1MG CATHEPSIN B INHIBITOR II 1488
219386-100UL ANTI-CATHEPSIN K RABBIT PAB 2896
219387-100UL ANTI-CATHEPSIN L RABBIT PAB 2925
219392-25MG CATHEPSIN B SUBSTRATE III, FLUOROGENIC 1588
219393-1MG CATHEPSIN S INHIBITOR 1555
219394-50UG CATHEPSIN D, HUMAN SPLEEN 6494
219396-1000U CATHEPSIN D, BOVINE SPLEEN 7045
219399-10MG CATHEPSIN D SUBSTRATE I 1237
219401-15U CATHEPSIN D, HUMAN LIVER 4647
219401-30U CATHEPSIN D, HUMAN LIVER 6552
219402-25UG CATHEPSIN L, HUMAN LIVER 4363
219404-25UG CATHEPSIN H, HUMAN LIVER 3159
219407-25MG CATHEPSIN G SUBSTRATE I, COLORIMETRIC 1739
219408-1ML ANTI-CATHEPSIN B RABBIT PAB 4636
219410-25MG CATHEPSIN G SUBSTRATE II, COLORIMETRIC 2190
219415-1MG CATHEPSIN INHIBITOR I 1906
219417-1MG CATHEPSIN INHIBITOR II 1906
219419-1MG CATHEPSIN INHIBITOR III 1906
219420-1MG CATHEPSIN/SUBTILISIN INHIBITOR 1906
219421-1MG CATHEPSIN L INHIBITOR I 1521
219426-5MG CATHEPSIN L INHIBITOR II 1137
219427-5MG CATHEPSIN L INHIB III 1939
219428-1SET CDK INHIBITOR SET 3042
219433-1MG CATHEPSIN L INHIBITOR IV 1338
219435-1MG CATHEPSIN L INHIBITOR V 1555
219437-100UL PD ANTI-CDC2 (PTYR15) RABBIT PAB 5075
219440-100UL PD ANTI-CDK1 (PTYR15) RABBIT PAB 5017
219441-10T PD ANTI-CDK1 SUB (PTHR14,TYR15) RB PAB 5017
219442-1MG CDK2 INHIBITOR 2290
219445-1MG CDK2 INHIBITOR II 736
219445-5MG CDK2 INHIBITOR II 2290
219448-5MG CDK2/5 INHIBITOR 1739
219451-500UG CDK5 SUBSTRATE 1087
219457-1MG CDK INHIBITOR, P35 1338
219458-25GM D(+)CELLOBIOSE 836
219461-25UG CATHEPSIN K,HIS*TAG,HU,RECOM,E.COLI 2516
219463-10UG CATHEPSIN E, HISTAG, MO., REC., NSO CELL 5767
219465-10MG CELASTROL, CELASTRUS SCANDENS 2507
219466-100KU CELLULYSIN CELLULASE, TRICHODERMA VIRIDE 2558
219466-200KU CELLULYSIN CELLULASE, TRICHODERMA VIRIDE 4597
219466-50KU CELLULYSIN CELLULASE, TRICHODERMA VIRIDE 1471
219467-10UG CATHEPSIN V, HISTAG, HU., REC., NSO CELL 5767
219468-1KIT CB-PROTEIN ASSAY KIT 2980
219469-10MG CELL SHEET MIGRATION INHIB, LOCOSTATIN 2257
219475-25MG CENTA B-LACTAMASE SUBSTRATE 3243
219476-1MG CDK4 INHIBITOR 1555
219477-5MG CDK4 INHIBITOR II, NSC 625987 2207
219478-5MG CDK4 INHIBITOR III 2324
219479-5MG CDC2-LIKE KINASE INHIBITOR, TG003 1555
219482-1MG CAVEOLIN-1 SCAFFOLDING DOMAIN PEPTIDE 2725
219483-1MG CAVEOLIN-1 SCAFFOLD DOM PEPTIDE NEG CTRL 3911
219485-1MG LACTOSYL CERAMIDE, PORCINE 2608
219489-1MG CERAMIDE KINASE INHIBITOR, K1 3226
219491-1MG CDK/CRK INHIBITOR 2324
219492-5MG CDK4/6 INHIBITOR IV 2303
219494-5MG CDK/CKI INHIBITOR, (R)-DRF053 3131
219497-2MG CATHEPSIN L SUBSTRATE I, FLUOROGENIC 2507
219498-1MG CATHEPSIN S SUBSTRATE, FLUOROGENIC 2633
219499-5MG CEP-701 3138
219501-5MG CDK Inhibitor II, LGR1406 1288
219505-10MG CBF BETA INHIBITOR 1505
219537-5MG D-ERYTHRO-SPHINGOSINE, DIHYDRO-, N-AC 1187
219540-5MG D-ERYTHRO-SPHINGOSINE, N-OCTANOYL- 1187
219555-1MG CATHEPSIN K SUBSTRATE II, FLUOROGENIC 2137
219557-5MG CERULENIN, CEPHALOSPORIUM CAERULENS 1488
219650-100GM CESIUM CHLORIDE, MB GRADE 2240
219650-500GM CESIUM CHLORIDE, MB GRADE 8641
219656-100UL ANTI-CETP (131-142) MOUSE MAB (ATM192) 4695
219670-5MG CFTR INHIBITOR-172 1939
219671-5MG CFTR INHIBITOR II, GLYH-101 2223
219673-10MG CFTR-F508del Corrector II, Corr-4a 1348
219676-5MG CFTR-F508DEL CORRECTOR, KM11060 1421
219677-10MG CFTR Inhibitor IV, PPQ-102  1488
220005-5MG CGP-37157 2274
220201-10GM CHAPS 3577
220201-1GM CHAPS 569
220201-25GM CHAPS 7104
220201-5GM CHAPS 1872
220202-1GM CHAPSO 1371
220202-5GM CHAPSO 5081
220285-5MG CHELERYTHRINE CHLORIDE 1872
220320-1MG CHETOMIN, CHAETOMIUM SP. 4430
220334-10UG CHARYBDOTOXIN, RECOMB. 2223
220334-5UG CHARYBDOTOXIN, RECOMB. 1521
220411-5GM CHENODEOXYCHOLIC ACID, SODIUM SALT 2725
220467-10MG 2-CHLORO-2'-DEOXYADENOSINE 936
220477-10U CHITOSANASE, STREPTOMYCES SP. N174 2758
220479-10UG CHK1, HUMAN, HIS TAG, RECOMBINANT 5917
220480-5GM 4-CHLORO-1-NAPHTHOL 1304
220485-500UG CHK2 INHIBITOR 3644
220486-1MG CHK2 INHIBITOR II 1739
220487-20UG CHK2, HIS*TAG, ACTIVE, HUMAN, REC. 4998
220489-1MG CHKTIDE 2137
220551-100GM CHLORAMPHENICOL 2725
220551-25GM CHLORAMPHENICOL 836
220551-500GM CHLORAMPHENICOL 9460
220557-100MG CHLORHEXIDINE, DIHCL 519
220588-250MG CHLOROPHENOLRED-B-D-GALACTOPYRANOSIDE 1521
227001-200UG ANTI-CCR2 (AB-1) GOAT PAB 3883
227010-100UG ANTI-CCR10 (9-31) GOAT PAB 4900
227011-100UG ANTI-CCR10 (4-31) GOAT PAB 4900
227013-5MG CCR4 ANTAGONIST 1972
227016-5MG CCR2 ANTAGONIST 2469
227020-100UL ANTI-CCR1 (7-24) RABBIT PAB 4973
227036-1MG CHOLERA TOXIN, VIBRIO CHOLERAE 3304
227039-1MG CHOLERA TOXIN, B SUBUNIT 10041
227040-100UL ANTI-CHOLERA TOXIN, B-SUBUNIT GOAT PAB 907
227041-100UG CHOLERA TOXIN, B SUB, INABA 569B, HRP 5672
228111-5GM CHOLESTEROL, HIGHLY PURIFIED 702
228180-1000U CHOLESTEROL ESTERASE, MICROBIAL 3744
228230-100IU CHOLESTEROL OXIDASE, NOCARDIA SP. 1318
228250-500U CHOLESTEROL OXIDASE, STREPTOMYCES SP. 4998
229101-250GM CHOLIC ACID, SODIUM SALT 2591
229101-50GM CHOLIC ACID, SODIUM SALT 1137
229102-1GM CHOLIC ACID, SODIUM SALT, ULTROL GRADE 753
229102-5GM CHOLIC ACID, SODIUM SALT, ULTROL GRADE 2842
230699-5GM CHONDROITIN SULFATE, BOVINE TRACHEA 1070
230734-1MG CHORIONIC GONADOTROPIN, STD. GR. 619
230734-2.5MG CHORIONIC GONADOTROPIN, STD. GR. 1237
230746-1MG ANTI-B-CG MO MAB (P3G7) 2384
230751-5MG CHROMECEPTIN 2223
230752-10MG CHROMOMYCIN A3 2324
230780-10U CHYMASE, HUMAN SKIN 5311
230790-10MG CHYMOSTATIN 2234
230790-25MG CHYMOSTATIN 4591
230790-5MG CHYMOSTATIN 1302
230832-2MU A-CHYMOTRYPSIN, BOVINE PANCREAS 1053
230834-200MG CHYMOTRYPSIN, BOV. , HIGH PURITY, EF 2929
230834-500MG CHYMOTRYPSIN, BOV. , HIGH PURITY, EF 3925
230900-50UG CHYMOTRYPSIN, HUMAN PANCREAS 3000
230912-10MG CHYMOTRYPSIN SUBSTRATE I, COLORIMETRIC 1939
230914-25MG CHYMOTRYPSIN SUBSTRATE II, FLUOROGENIC 1388
230950-5MG CIGLITAZONE 2140
231000-5UG CILIARY NEUROTROPHIC FACTOR, RAT, RECOM 4012
231085-10MG CILOSTAMIDE 2974
231180-5MG CITCO 1421
231246-50UL ANTI-CITRULLINE RABBIT PAB 3759
231405-500MG CLOFIBRATE 853
231576-100UG PD ANTI-CSK II SUB, MO MAB (9F4) 4900
232120-50MG CISPLATIN 1338
233100-1MG CL-387,785 1822
233105-5MG CL-82198 2612
233152-1GM DITHIOERYTHRITOL 669
233152-5GM DITHIOERYTHRITOL 1889
233153-10GM CLELAND'S REAGENT, ULTROL GRADE 6285
233153-1GM CLELAND'S REAGENT, ULTROL GRADE 953
233153-5GM CLELAND'S REAGENT, ULTROL GRADE 3811
233155-100GM CLELAND'S REAGENT 14324
233155-10GM CLELAND'S REAGENT 2708
233155-1GM CLELAND'S REAGENT 552
233155-25GM CLELAND'S REAGENT 5616
233155-5GM CLELAND'S REAGENT 1471
233156-10GM CLELAND'S REAGENT, MB GRADE 3460
233156-1GM CLELAND'S REAGENT, MB GRADE 652
233157-1GM CLELAND'S REDUCTACRYL REAGENT 2141
233165-1GM CLIOQUINOL 836
233170-200UL ANTI-CLOCK (11-30) RABBIT PAB 5489
233183-10MG CLODRONATE, DISODIUM SALT 1488
233230-100MG CLOTRIMAZOLE 468
233264-1MG CMP-SIALIC ACID, DISODIUM SALT 572
233264-25MG CMP-SIALIC ACID, DISODIUM SALT 10262
233264-5MG CMP-SIALIC ACID, DISODIUM SALT 2390
233266-25U CMP-SIALIC ACID SYNTHETASE, RECOM 4012
233279-100U COAGULATION FACTOR IX, HUMAN PLASMA 9343
233282-100U COAGULATION FACTOR X, HUMAN PLASMA 6703
233290-500UG COAGULATION FACTOR, IXAB, HUMAN PLASMA 9176
233480-100UG COAGULATION FACTOR XI, HUMAN PLASMA 5048
233483-100UG COAGULATION FACTOR XIA, HUMAN PLASMA 5048
233490-500UG COAGULATION FACTOR XII, HUMAN PLASMA 5650
233493-500UG COAGULATION FACTOR A-XIIA, HUMAN PLASMA 9293
233501-100UG COAGULATION FACTOR XIII, HUMAN PLASMA 5382
233526-10U COAGULATION FACTOR XA, HUMAN PLASMA 2558
233552-1MG COBRA VENOM FACTOR 4697
233630-10MG CRYPTOTANSHINONE 1584
233900-250UG COELENTERAZINE 3661
233903-50UG COELENTERAZINE-H, SYNTHETIC 1906
234101-100MG COENZYME A, TRILITHIUM SALT 2457
234109-5MG COLCEMID 1438
234112-250MG COLLAGEN, CALF SKIN 3995
234112-50MG COLLAGEN, CALF SKIN 1705
234115-1GM COLCHICINE, COLCHICUM AUTUMNALE 1727
234115-5GM COLCHICINE, COLCHICUM AUTUMNALE 8363
234133-10KU COLLAGENASE, PARALITHODES CAMTSCHATICA 1338
234134-250U COLLAGENASE, TYPE III, C, HISTOLYTICUM 3243
234138-1MG COLLAGEN, TYPE I, HUMAN SKIN 4814
234140-5MG COLLAGENASE INHIBITOR I 1020
234149-250UG COLLAGEN, TYPE I, HUMAN PLACENTA 5081
234153-100MG COLLAGENASE, TYPE I, C, HISTOLYTICUM 769
234153-1GM COLLAGENASE, TYPE I, C, HISTOLYTICUM 3845
234154-100UG COLLAGEN, TYPE IV, HUMAN PLACENTA 5248
234155-100MG COLLAGENASE, TYPE II, C, HISTOLYTICUM 1120
234161-250UG COLLAGEN, TYPE V, HUMAN PLACENTA 7053
234167-500UL ANTI-COLLAGEN, TYPE I RABBIT PAB 3847
234168-500UL ANTI-COLLAGEN, TYPE I, CNBR FRAG RB PAB 3803
234169-500UL ANTI-COLLAGEN TYPE I/III CNBRFRAG RB PAB 3803
234184-1MG COLLAGEN TYPE II BOVINE JOINT CARTILAGE 3761
234187-500UL ANTI-COLLAGEN, TYPE II RABBIT PAB 4457
234188-500UL ANTI-COLLAGEN, TYPE II, CNBR FRAG RB PAB 3803
234189-500UL ANTI-COLLAGEN, TYPE III CNBR FRAG RB PAB 3803
234191-500UL ANTI-COLLAGEN, TYPE VI RABBIT PAB 3803
234192-500UL ANTI-COLLAGEN, TYPE VII RABBIT PAB 3847
234194-500UL ANTI-COLLAGEN, TYPE IX RABBIT PAB 4666
234196-500UL ANTI-COLLAGEN, TYPE X RABBIT PAB 5489
234200-10MG COMBRETASTATIN A-4 1674
234365-1ML ANTI-COMPLEMENT 2 GOAT PAB 2735
234370-5UG G-CS FACTOR, HU., RECOM 6168
234371-5UG GC-S FACTOR, MOUSE, RECOM 4697
234373-5UG GMC-STIMULATING FACTOR, HU., R. 5666
234374-10UG GMC-S FACTOR, MOUSE, R. 5817
234376-5UG MCSF, HU., RECOM 4028
234378-10UG MCSF, MOUSE, RECOM 5014
234390-1ML ANTI-COMPLEMENT 1Q GOAT PAB 1360
234395-5ML COMPLEMENT, GUINEA PIG SERUM 1554
234397-100UG COMPLEMENT C5A, HISTAG, HU., RECOM 13083
234400-5ML COMPLEMENT, RABBIT SERUM 2641
234401-1ML C1Q-DEPLETED SERUM, HUMAN 2725
234402-1ML C2-DEPLETED SERUM, HUMAN 2725
234403-1ML C3-DEPLETED SERUM, HUMAN 3661
234405-1ML C5-DEPLETED SERUM, HUMAN 2725
234409-1ML C9-DEPLETED SERUM, HUMAN 2725
234410-1ML FACTOR B-DEPLETED SERUM, HUMAN 2725
234415-1MG C5A RECEPTOR ANTAGONIST, W-54011 1638
234415-5MG C5A RECEPTOR ANTAGONIST, W-54011 5081
234450-1MG LAVENDUSTIN C 1137
234490-1MG PD 153035 (AG 1517) 1622
234491-500UG INSOLUTION(TM) PD 153035 (AG1517) 1572
234501-5MG COMPOUND 401 2758
234503-1MG COMPOUND 52 1221
234505-500UG COMPOUND 56 2287
234567-1GM CONCANAVALIN A, CANAVALIA ENSIFORMIS 8101
234567-250MG CONCANAVALIN A, CANAVALIA ENSIFORMIS 1287
234568-5ML CONA-AGAROSE 1475
234590-1EA CONCANAVALIN A PLATE, CLEAR POLYSTYRENE 1042
234599-100MG CONDURITOL B EPOXIDE 5981
234610-500MG CONGO RED, HIGH PURITY 970
235035-1MG CORONAVIRUS MAIN PROTEINASE INHIBITOR 1451
235135-1GM CORTICOSTERONE 2040
235400-5MG CASPASE-3 SUBSTRATE I, COLORIMETRIC 1822
235412-100UL ANTI-CASPASE-3 RABBIT PAB 4753
235414-100U CASPASE-3, MOUSE, RECOMBINANT, E. COLI 5950
235415-100U CASPASE-3, RAT, RECOMBINANT, E. COLI 5950
235417-5000U CASPASE-3, HUMAN, RECOMBINANT, E. COLI 5633
235418-1KIT CASPASE-3 INHIBITOR SCREENING ASSAY KIT 9084
235419-1KIT CASPASE-3 CELLULAR ACTIVITY ASSAY KIT 6669
235420-1MG CASPASE-3 INHIBITOR I 1304
235420-5MG CASPASE-3 INHIBITOR I 5148
235421-1MG CASPASE-3 INHIBITOR IV 1538
235421-5MG CASPASE-3 INHIBITOR IV 5115
235422-1MG CASPASE-3 INHIBITOR I, BIOTIN CONJUGATE 2190
235423-1MG CASPASE-3 INHIBITOR I, CELL-PERMEABLE 3009
235425-1MG CASPASE-3 SUBSTRATE II, FLUOROGENIC 1271
235425-5MG CASPASE-3 SUBSTRATE II, FLUOROGENIC 4998
235427-1MG INSOLUTION CASPASE-3 INHIBITOR I, CELL-P 3009
235429-1SET CASPASE INHIBITOR SET I 7404
235430-1KIT CASPASE3 INTRACELLULAR ACTIVITY ASSAY I 8930
235432-1KIT CASPASE3 INTRACELLULAR ACTIVITY ASSAY II 8930
235706-5UG CSK, GST-FUSION PROTEIN, HU., RECOM 1939
235752-1ML ANTI-C-REACTIVE PROTEIN RABBIT PAB 1273
236002-50UG ANTI-COX2, C-TERMINAL RABBIT PAB 4037
236004-100UG ANTI-COX2 MOUSE MAB (5E10/D10) 6175
236005-5MG COX-1 INHIBITOR, FR122047 2407
236007-10MG COX-1 INHIBITOR IV, TFAP 1953
236011-5MG COX-2 INHIBITOR I 3226
236012-5MG COX-2 INHIBITOR II 2207
236013-25MG COX-2 INHIBITOR III 2324
236014-25MG COX-2 INHIBITOR IV 2324
236015-5MG COX-2 INHIBITOR V, FK3311 2137
236020-5MG ETOMOXIR 1660
236600-1MG C-REACTIVE PROTEIN, HUMAN ASCITES 3761
236603-100UG C-REACTIVE PROTEIN, SERUM, HIGH PURITY 1471
236608-1MG C-REACTIVE PROTEIN, HU., RECOM 3410
237911-1GM CREATINE PHOSPHATE, DIPOTASSIUM SALT 8925
237911-250MG CREATINE PHOSPHATE, DIPOTASSIUM SALT 1407
2380-25GM CREATINE PHOSPHATE, DISODIUM SALT 3410
2380-5GM CREATINE PHOSPHATE, DISODIUM SALT 936
238395-5KU CREATINE PHOSPHOKINASE, PORCINE HEART 1471
238407-50IU CREATINE PHOSPHOKINASE-MM ISOENZYME 1451
2384-20MG CREATINE PHOSPHOKINASE, SKELETAL MUSCLE 1421
238464-1MG CREBTIDE 1521
238465-100UG ANTI-CREB (123-136) RABBIT PAB 4695
238466-100UL PD ANTI-CREB (PSER133) RABBIT PAB 4900
238467-1SET PD ANTI-CREB (PSER133) MOUSE MAB (10E9) 5265
238540-30ML CHROMOSAVE REAGENT 1271
238590-1MG CUCURBITACIN I, CUCUMIS SATIVUS L. 3026
238702-50UL ANTI-AB-CRYSTALLIN PEP (163-175) RB PAB 3627
238803-1MG CDK2 INHIBITOR III 1070
238803-5MG CDK2 INHIBITOR III 3728
238804-5MG CDK2 INHIBITOR IV, NU6140 2591
238806-5MG CDK2/9 INHIBITOR 3159
238807-5MG CDK/CYCLIN INHIBITORY PEPTIDE III 3393
238808-2MG CDK/CYCLIN INHIBITORY PEPTIDE III, CELL- 3393
238811-5MG CDK9 INHIBITOR II *CAN508* 3042
238900-1MG 4-CYANO-3-METHYLISOQUINOLINE 3796
239760-25GM B-CYCLODEXTRIN 753
239760-500GM B-CYCLODEXTRIN 6853
239763-1GM CYCLOHEXIMIDE 919
239763-5GM CYCLOHEXIMIDE 2649
239764-100MG CYCLOHEXIMIDE, H. P. 520
239764-1GM CYCLOHEXIMIDE, H. P. 1984
239765-1ML INSOLUTION(TM) CYCLOHEXIMIDE 919
239775-1GM CYCLOHEXYL-N-HEXYL-B-D-MALTOSIDE, ULTROL 2324
239777-100UG CYCLOPHILIN A, HU., RECOM 6485
239778-100UL ANTI-CYCLOPHILIN A RABBIT PAB 4900
239779-100GM CHES, ULTROL GRADE 1104
239780-100UL ANTI-CYCLOPHILIN 40 RABBIT PAB 4900
239782-100GM CAPS, ULTROL GRADE 953
239782-1KG CAPS, ULTROL GRADE 4613
239783-1SET CYCLOOXYGENASE INHIBITOR SET 5733
239784-100UG ANTI-CYCLOPHILIN D (42-54) RABBIT PAB 4695
239785-1GM CYCLOPHOSPHAMIDE MONOHYDRATE 1287
239799-1MG CERULOPLASMIN, HUMAN PLASMA 4279
239802-100MG CURCUMIN, CURCUMA LONGA L. 652
239803-1MG CYCLOPAMINE, V. CALIFORNICUM 2324
239804-100UG CYCLOPAMINE-KAAD 2701
239805-5MG CYCLOPIAZONIC ACID, P. CYCLOPIUM 1003
239820-5MG CXCR4 ANTAGONIST I, AMD3100 1302
239831-1GM D-CYCLOSERINE 736
239831-5GM D-CYCLOSERINE 2725
239835-100MG CYCLOSPORIN A, TOLYPOCLADIUM INFLATUM 1304
239900-10MG CYPERMETHRIN 1287
240891-500UG CYSTATIN, EGG WHITE 6002
240896-50UG CYSTATIN C, HUMAN URINE 1488
243005-100GM L-CYSTEINE, FREE BASE 1889
243005-1KG L-CYSTEINE, FREE BASE 6636
243005-25GM L-CYSTEINE, FREE BASE 351
2430-100GM L-CYSTEINE, HCL 953
2430-1KG L-CYSTEINE, HCL 3945
2470-25GM L-CYSTINE 535
250225-1MG CYTOCHALASIN B, DIHYDRO- 1287
250233-5MG CYTOCHALASIN B, H. DEMATIOIDEUM 2106
250234-1MG CYTOCHALASIN E, ASPERGILLUS CLAVATUS 1137
250255-1MG CYTOCHALASIN D, ZYGOSPORIUM MANSONII 1705
250301-100UG CYTOCHROME B5, HUMAN, RECOMB., E. COLI 4714
250306-100UL ANTI-CYTOCHROME P450 2E1,HU(RB) 4739
250308-100UL ANTI-CYTOCHROME P450 3A4 RABBIT PAB 4739
250330-1MG CYTOCHROME P450 1B1 INHIBITOR, TMS 2608
250600-100MG CYTOCHROME C, EQUINE HEART 1119
250600-1GM CYTOCHROME C, EQUINE HEART 14288
251010-1GM 1-B-D-ARABINOFURANOSYLCYTOSINE 1287
251400-5MG D609, POTASSIUM SALT 2056
251500-1MG DAF-2 5599
251505-1MG DAF-2 DA 5765
251515-1MG DAF-FM 9410
251520-1MG DAF-FM DA 9410
251600-25MG DAIDZEIN 870
251650-1MG DAMNACANTHAL 2526
251680-100MG DANTROLENE, SODIUM SALT 1020
251700-5MG 1,5-DANSYL-GLU-GLY-ARG CMK, 2HCL 3744
251760-1MG DAR-4M 9410
251765-1MG DAR-4M AM 10028
251800-5MG DAUNORUBICIN, HCL 1120
252000-5GM DDMAB 1588
252718-1GM N-DECYL-B-D-MALTOPYRANOSIDE, ULTROL 1588
252718-5GM N-DECYL-B-D-MALTOPYRANOSIDE, ULTROL 5733
252721-1GM N-DECANOYLSUCROSE 1003
252721-5GM N-DECANOYLSUCROSE 4028
252740-5MG DEGUELIN, MUNDULEA SERICEA 1287
252750-1GM DEFEROXAMINE MESYLATE 1388
252805-10GM DHEA 1855
252926-10MG N-ACETYLNEURAMINIC ACID 2,3-DEHYDRODEOXY 2608
253300-10MG DELTAMETHRIN 1451
253500-5MG DENBUFYLLINE 3209
256455-1GM BIG CHAP, DEOXY 6273
256455-250MG BIG CHAP, DEOXY 1187
259544-5MG DEOXYGALACTONOJIRIMYCIN, HCL 2959
259580-1GM 2-DEOXY-D-GALACTOSE 1672
25972-1GM 2-DEOXY-D-GLUCOSE 753
260010-5MG DEMETHYLASTERRIQUINONE B1 4563
260575-5MG 1-DEOXYMANNOJIRIMYCIN, HCL 1906
260585-50MG 5'-DEOXY-5'-METHYLTHIOADENOSINE 1421
260684-10MG 1-DEOXYNOJIRIMYCIN, HCL 3276
260684-1MG 1-DEOXYNOJIRIMYCIN, HCL 736
260913-10MU DNASE I, BOVINE PANCREAS 2622
260913-25MU DNASE I, BOVINE PANCREAS 5339
260920-10MG DNA METHYLTRANSFERASE INHIBITOR RG108 3911
260930-25MG DNA POLYMERASE SLIDINGCLAMPINHIBITOR,RU7 1718
260960-10MG DNA-PK INHIBITOR 1271
260961-5MG DNA-PK INHIBITOR II 2624
260962-1MG DNA-PK INHIBITOR III 1555
260964-1MG DNA-PK INHIBITOR V 1689
260964-5MG DNA-PK INHIBITOR V 5365
2618-1GM DNA, SODIUM SALT, CALF THYMUS 3326
2618-250MG DNA, SODIUM SALT, CALF THYMUS 1137
262012-1GM DNA, SODIUM SALT, SALMON TESTES 836
262012-5GM DNA, SODIUM SALT, SALMON TESTES 3661
262015-25MG DNA BASE EXCISION REPAIR PATH INHIBITOR 1438
263200-1MG DEPHOSTATIN 1739
263225-500MG DEQUALINIUM CHLORIDE 1053
263275-5MG DESMOSINE 2892
263301-250MG DERMATAN SULFATE, PORCINE INTESTINAL M. 5081
263451-1SET DETERGENT TEST SET 5599
263454-1MEDI DETERGENT-OUT, SDS REMOVAL KIT 3458
263455-1MEDI DETERGENT-OUT, DETERGENT REMOVAL KIT 3821
263455-1MINI DETERGENT-OUT, DETERGENT REMOVAL KIT 2639
263458-1EA DETERGENT VARIETY PACK 2624
264101-100GM DEOXYCHOLIC ACID, SODIUM SALT 1254
264101-1KG DEOXYCHOLIC ACID, SODIUM SALT 8240
264101-25GM DEOXYCHOLIC ACID, SODIUM SALT 535
264103-25GM DEOXYCHOLIC ACID, SODIUM , ULTROL 5616
264103-5GM DEOXYCHOLIC ACID, SODIUM , ULTROL 1455
264150-1MG CASPASE-3 SUBSTRATE IV, FLUOROGENIC 1371
264150-5MG CASPASE-3 SUBSTRATE IV, FLUOROGENIC 5432
264151-1MG CASPASE-3 SUBSTRATE VII, FLUOROGENIC 1488
264151-5MG CASPASE-3 SUBSTRATE VII, FLUOROGENIC 5666
264155-1MG CASPASE-3 INHIBITOR II 4363
264155-250UG CASPASE-3 INHIBITOR II 1555
264156-250UG INSOLUTION(TM) CASPASE-3 INHIBITOR II 1555
265005-100MG DEXAMETHASONE 1187
265152-10GM DEXTRAN SULFATE, NA, MB GRADE 936
265152-50GM DEXTRAN SULFATE, NA, MB GRADE 2608
266785-5MG DIACYLGLYCEROL KINASE INHIBITOR I 1689
266788-5MG DIACYLGLYCEROL KINASE INHIBITOR II 1689
267430-25MG P1,P5-DI(ADENOSINE-5'-)-PENTA-PHOSPHATE 1856
268298-10MG DAPI, DIHCL 2106
281751-10ML DAB, TETRAHYDROCHLORIDE 1455
281753-50ML DAB SUBSTRATE BUFFER 853
286888-100MG BHQ 452
286891-1MG BH3I-2' 1003
286891-5MG BH3I-2' 3343
28745-100MG N(6),O(2')-DIBUTYRYL-CAMP, SODIUM SALT 4797
28745-25MG N(6),O(2')-DIBUTYRYL-CAMP, SODIUM SALT 1471
287810-100MG 2',7'-DICHLOROFLUORESCIN DIACETATE 1134
287815-10MG 3,4-DICHLOROISOCOUMARIN 2407
287840-1GM DICLOFENAC SODIUM 519
287891-50MG 5,6-DICHLORO-1-B-D-RIBOFURANOSYLBENZIMID 1739
287892-10UMOL 5,6-DICL-RIBOFURANOSYLBENZIMI 3,5-CYCLIC 7221
287893-5UMOL 5,6-DICL-1-B-D-RIBOFURANOSYLBENZIMI 3,5* 6602
287895-1MG DROSOPHILA ANTENNAPEDIA HOMEO-DOMAIN 1689
287897-500MG DICOUMAROL 936
288104-1MG 2',5'-DIDEOXYADENOSINE 987
288500-25MG DL-A-DIFLUOROMETHYLORNITHINE, HCL 1304
292500-10MG DIETHYLAMINE NONOATE 602
292505-1MG DIETHYLAMINE NONOATE/AM 1672
292505-5MG DIETHYLAMINE NONOATE/AM 5382
298711-100GM DIETHYL PYROCARBONATE 5182
298711-25GM DIETHYL PYROCARBONATE 1471
300230-10MG D-ERYTHRO-SPHINGOSINE, DIHYDRO- 1521
300260-10MG DIPHENYLENEIODONIUM CHLORIDE 1137
300265-1GM DPC 1003
300267-50MG DPPH, FREE RADICAL 769
300270-1MG PARP INHIBITOR III, DPQ 1421
300410-1GM DIGITONIN, HIGH PURITY 5666
300410-250MG DIGITONIN, HIGH PURITY 1822
300410-5GM DIGITONIN, HIGH PURITY 22107
30967-1GM DFP 4247
309795-250MG DIDS, DISODIUM SALT 1939
309800-25MG DIHYDROETHIDIUM 2190
309810-10MG DIHYDROKAINIC ACID, NATURAL 3243
309825-5MG DIHYDRORHODAMINE 123 2838
309866-100MG DILTIAZEM, HCL 1087
310500-5MG D-ERTHYRO-SPHINGOSINE, N,N-DIMETHYL- 1555
311155-1GM DANSYL CHLORIDE 753
311203-25MG N(G),N(G)-DIMETHYL-L-ARGININE, DIHCL 1856
311204-25MG N(G),N(G)'-DIMETHYL-L-ARGININE, DIHCL 1104
311250-10MG 1,4-DIMETHYLENDOTHALL 1421
317200-10MG DMBI 1137
317210-5MG DM-NITROPHEN REAGENT, TETRASODIUM SALT 5443
317232-10MG DMNQ 3728
317240-5GM 1,1-DIMETHYLBIGUANIDE, HYDROCHLORIDE 1018
317275-100ML DIMETHYL SULFOXIDE 468
317275-500ML DIMETHYL SULFOXIDE 853
317282-100UG ANTI-DNMT3A (86-100) RABBIT PAB 4446
317290-5MG DIMINUTOL 2858
317496-10MG  Dual Specificity Protein Phosphatase 1/6 Inhibitor, BCI  949
317505-10MG 1,2-DIOCTANOYL-SN-GLYCEROL 1087
317630-10MIU DIPEPTIDYLPEPTIDASE IV, HUMAN PLACENTA 7154
317638-1MG DIPEPTIDYLPEPTIDASE IV INHIBITOR II 2167
317639-5MIU DIPEPTIDYLPEPTIDASE IV,HIS*TAG,HU.,RECOM 6273
317640-250MIU DIPEPTIDYL PEPTIDASE IV (CD26), PORCINE 4975
317641-5MG DIPEPTIDYLPEPTIDASE IV INHIBITOR III 2642
317642-5MG DIPEPTIDYLPEPTIDASE IV INHIBITOR IV, K57 2833
320900-1MG DOLASTATIN 15 3042
322123-5GM 5,5'-DITHIO-BIS-(2-NITROBENZOIC ACID) 1003
322133-100MG DSP, WATER-SOLUBLE 2354
322326-1MG DIPHTHERIA TOXIN, UNNICKED 7123
322327-1MG DIPHTHERIA TOXIN, CRM MUTANT 8989
322328-100MG DIPYRIDAMOLE 619
322337-2MG DVL-PDZ DOMAIN INHIBITOR, PEPTIDE PEN-N3 1256
322338-10MG Dvl-PDZ Domain Inhibitor II 849
323110-100UG ANTI-DNAK, E. COLI MOUSE MAB (8E2/2) 3847
323115-25MG DNA REPAIR PATHWAY INHIBITOR, NS-123 2407
324101-100MG DNP-ALBUMIN CONJUGATE, BOVINE 2334
324121-100MG DNP-HEMOCYANIN CONJUGATE, KEYHOLE LIMPET 1605
324351-1GM N-DODECYL-B-D-GLUCOPYRANOSIDE 1889
324355-1GM N-DODECYL-B-D-MALTOSIDE, ULTROL GRADE 1772
324355-25GM N-DODECYL-B-D-MALTOSIDE, ULTROL GRADE 23449
324355-500MG N-DODECYL-B-D-MALTOSIDE, ULTROL GRADE 919
324355-5GM N-DODECYL-B-D-MALTOSIDE, ULTROL GRADE 6318
324374-5GM N-DODECANOYLSUCROSE 6906
324378-1MG DOMOIC ACID, MYTILUS EDULIS 1956
324380-10MG DOXORUBICIN, HCL 2858
324381-30UG ANTI-DOPA DECARBOXYLASE RABBIT PAB 4461
324385-1GM DOXYCYCLINE, HCL 753
324390-100UL ANTI-DOPAMINE D1 RECEPTOR RABBIT PAB 4914
324393-100UL ANTI-DOPAMINE D2 RECEPTOR RABBIT PAB 4914
324396-100UL ANTI-DOPAMINE D2S RECEPTOR RABBIT PAB 4841
324402-100UL ANTI-DOPAMINE D3 RECEPTOR RABBIT PAB 4914
324405-100UL ANTI-DOPAMINE D4 RECEPTOR RABBIT PAB 4914
324408-100UL ANTI-DOPAMINE D5 RECEPTOR RABBIT PAB 4841
324410-10MG DYNAMIN INHIBITOR I, DYNASORE 1605
324411-500MG DYNAMIN INHIBITOR II, MITMAB 903
324446-100UG ANTI-DYRK SHEEP PAB 4315
324461-10MG E2F INHIBITOR, HLM006474 1871
324470-5MG E-4031 3677
324473-1MG PARP INHIBITOR IX, EB-47 1354
324483-5MG EBSELEN 1204
324503-100GM EDTA  2NA DIHYDRATE  MB GRADE 602
324503-1KG EDTA, 2NA,DIHYDRATE, MB GRADE 2190
324504-500ML EDTA, 500 MM SOLN, PH 8.0, ULTROL 1120
324506-100ML EDTA, 0.5 M, PH 8.0, MBG,DEPC-TREATED 702
324515-5MG EEF-2 KINASE INHIBITOR, NH125 3042
324517-10MG EIF4E/EIF4G INTERACTION INHIBITOR,4EGI-1 2925
324610-100UG ANTI-EARLY ENDOSOMAL ANTIGEN 1 RB PAB 4636
324620-100UG ANTI-EBP50 RABBIT PAB 4695
324622-1MG EG5 INHIBITOR III, DIMETHYLENASTRON 1438
324622-5MG EG5 INHIBITOR III, DIMETHYLENASTRON 4313
324623-5MG EG5 INHIBITOR IV, VS-83 3845
324624-5MG EG5 INHIBITOR V, TRANS-24 3393
324626-25GM EGTA, MB GRADE 1521
324628-10MG EGTA/AM 4790
324629-5MG EG5 INHIBITOR VI 3014
324630-10MG EHNA, HYDROCHLORIDE 1020
324631-5MG EG5 INHIBITOR VII 2340
324643-100UL PD ANTI-ELK1 (PSER383) RABBIT PAB 5075
32467-1GM ALBUMIN, CHICKEN EGG, 5X CRYSTALLINE 619
324673-1MG EGFR/ERBB-2 INHIBITOR 1605
324674-1MG EGFR INHIBITOR 1572
32467-5GM ALBUMIN, CHICKEN EGG, 5X CRYSTALLINE 2497
324676-100UG ELASTASE, PSEUDOMONAS AERUGINOSA 5182
324681-100UG ELASTASE, HUMAN NEUTROPHIL 5148
324681-50UG ELASTASE, HUMAN NEUTROPHIL 2892
324682-1000U ELASTASE, PORCINE PANCREAS, H.P.,CRYSTAL 8242
324682-250U ELASTASE, PORCINE PANCREAS, H.P.,CRYSTAL 2346
324683-500MG ELLAGIC ACID, DIHYDRATE 1053
324688-10MG ELLIPTICINE 1204
324691-5MG ELASTATINAL 1785
324692-1MG ELASTASE INHIBITOR I 1722
324693-250MG EMETINE, DIHCL 786
324694-50MG EMODIN 1335
324696-10MG ELASTASE SUBSTRATE I, COLORIMETRIC 903
324699-5MG ELASTASE SUBSTRATE IV, COLORIMETRIC 1207
324707-100ML ELUGENT DETERGENT, 50% SOLUTION 1053
324708-2UG ENDOPROTEINASE ASP-N, EXCISION GR. 1956
324711-1SET ENDOPROTEINASE ARG-C, EXCISION GRADE 1984
324712-20U ENDOPROTEINASE GLU-C, S. AUREUS 2216
324713-50UG ENDOPROTEINASE GLU-C, EXCISION GRADE 2040
324714-3U ENDOPROTEINASE LYS-C, L. ENZYMOGENES 4559
324715-5UG ENDOPROTEINASE LYS-C, EXCISION GRADE 2437
324716-50MIU ENDO-A-N-ACETYLGALACTOSAMINIDASE, RECOM 4714
324717-200MIU ENDOGLYCOSIDASE H, S. PLICATUS, RECOMB. 2725
324725-700MIU ENDOGLYCOSIDASE F1, RECOMB. 6832
324726-200MIU ENDOGLYCOSIDASE F2, RECOMB. 4697
324727-200MIU ENDOGLYCOSIDASE F3, RECOMB. 4697
324731-5MG ENDOMORPHIN-2 1271
324732-5MG ERBB-2 INHIBITOR II 2303
324740-25MG ELASTASE SUBSTRATE V, FLUOROGENIC 1488
324743-250UG ENDOSTATIN, HISTAG, MOUSE, RECOM 4780
324743-500UG ENDOSTATIN, HISTAG, MOUSE, RECOM 7037
324744-5MG ELASTASE INHIBITOR II 1822
324745-5MG ELASTASE INHIBITOR III 2428
324751-2MG ELASTIN, HUMAN LUNG, WATER-SOLUBLE 5833
324755-250UG ANTI-ENDOTHELIN B RECEPTOR C-TERM SH PAB 4841
324756-500UL ANTI-ELASTIN RABBIT PAB 5460
324759-1MG ELASTASE INHIBITOR IV, ONO-5046 1271
324760-20MG ENDOTHALL 1020
324762-100UG ENDOPEPTIDASE, NEUTRAL, PORCINE KIDNEY 4179
324782-10UG DAPK1, GST-FUSION, HUMAN, REC. 5399
324783-10UG EPHB4, GST-FUSION, HUMAN, REC. 5399
324787-25UL ANTI-ERP72 RABBIT PAB 3159
324788-10MG DAPK Inhibitor 889
324796-2U ENDOPEPTIDASE LYS-C, A. LYTICUS 3036
324798-500UG ENTEROTOXIN TYPE B 13892
324800-100UG EPOXOMICIN, SYNTHETIC 3706
324801-50UG INSOLUTION(TM) EPOXOMICIN, SYNTHETIC 2040
324813-25MG SOLUBLE EPOXIDE HYDROLASE INHIBITOR 1505
324824-50UG EPAC1 CAMP BINDING DOMAIN,HU,REC.,E.COLI 7272
324825-50UG EPAC2CAMPBINDINGDOMAIN,GST-FUSION,HU,REC 7272
324828-250UG ANTI-ELK RECEPTOR-CY DOMAIN SHEEP PAB 3964
324831-200UG EPIDERMAL GROWTH FACTOR, HUMAN, RECOMB. 3510
324832-5MG EGFR INHIBITOR II, BIBX 1382 3126
324833-5MG EGFR INHIBITOR III *TKS050* 2959
324839-1EA INHIBITORSELECTEGFRSIGNALINGPATHWAYINHIB 16560
324840-1MG EGFR/ERBB-2/ERBB-4 INHIBITOR 2324
324841-2MG EGF/FGF/PDGF RECEPTOR TYROSINE KINASE 1923
324842-5MG EGFR/ErbB-2/ErbB-4 Inhibitor II 2343
324845-15MG ENDOTHELIAL CELL GROWTH SUPPLEMENT, 1889
324856-100UG EGF, MURINE SUBMAXILLARY GLANDS, RECPT. 6168
324863-1SET PD ANTI-EGFR (PSER1047) MOUSE MAB (1H9) 4900
324864-1SET PD ANTI-EGFR (PTYR1173) MOUSE MAB (9H2) 5119
324865-10T PD ANTI-EGFR (PTYR845) RABBIT PAB 5017
324867-10T PD ANTI-EGFR(PTYR1068) RABBIT PAB 5017
324870-100UG ANTI-A-ENAC RABBIT PAB 4695
324874-100UG ANTI-B-ENAC (619-640) RABBIT PAB 4247
324875-25MG EICOSAPENTAENOIC ACID 1538
324876-10UG FAK, GST-FUSION, HUMAN, REC. 5048
324877-5MG FOCAL ADHESION KINASE INHIBITOR I 837
324878-5MG FOCAL ADHESION KINASE INHIBITOR II 2377
324880-10MG (-)-EPIGALLOCATECHIN GALLATE 753
324881-5UG PERK, GST-FUSION, HUMAN, RECOMB, E.COLI 3761
324888-10MG EPIGENETIC MULTIPLE LIGAND 1972
324890-1MG E-64 PROTEASE INHIBITOR 652
324890-25MG E-64 PROTEASE INHIBITOR 9794
324890-5MG E-64 PROTEASE INHIBITOR 2591
324895-5MG EIF-2ALPHA INHIBITOR, SALUBRINAL 2491
324896-5MG EIF-2 ALPHA INHIBITOR II, SAL003 2469
324900-100MG L-(-)-EPINEPHRINE-(+)-BITARTRATE 836
324905-5MG EPIRUBICIN HCL 2056
324930-1MG ERBSTATIN ANALOG 819
325001-10UG EPOTHILONE B, SYNTHETIC 2117
325540-7MG PROTEIN TYROSINE KINASE, CTRL, RAT SPLEN 1149
325877-10UG FGF-R1, GST-FUSION, HUMAN, REC. 5048
325879-10UG FGR, GST-FUSION, HUMAN, REC. 5048
325880-10UG FLT-3, GST-FUSION, HUMAN, REC. 5399
325881-10UG IGF-1R, GST-FUSION, HUMAN, REC. 5399
325882-10UG IRAK4, GST-FUSION, HUMAN, REC. 5048
325883-10UG JAK3, GST-FUSION, HUMAN, REC. 5098
325884-10UG JNK3, GST-FUSION, HUMAN, REC. 5048
325885-10UG MET, GST-FUSION, HUMAN, REC. 5048
325886-10UG MAPKAPK5, GST-FUSION, HUMAN, REC. 5399
325887-10UG MUSK, GST-FUSION, HUMAN, REC. 5399
325888-10UG NEK2, GST-FUSION, HUMAN, REC. 5399
325889-10UG PAK1, GST-FUSION, HUMAN, REC. 7122
325891-10UG PDGFR-ALPHA, GST-FUSION, HUMAN, REC. 4931
325892-10UG PDGFR-BETA, GST-FUSION, HUMAN, REC. 5198
325893-10UG SYK, GST-FUSION, HUMAN, REC. 5198
325894-10UG TIE2, GST-FUSION, HUMAN, REC. 5198
325895-10UG VEGF-R1, GST-FUSION, HUMAN, REC. 5198
325896-10UG WEE1, GST-FUSION, HUMAN, REC. 5198
325898-10UG CDK2/CYCA, GST-FUSION, HUMAN, REC. 5198
325899-10UG CDK4/CYCD1, GST-FUSION, HUMAN, REC. 5198
325900-10UG CDK6/CYCD1, GST-FUSION, HUMAN, REC. 5198
325901-10UG AURORA B, GST-HIS*TAG, HUMAN REC., S. FR 4680
325902-60UG FKBP12, GST-FUSION, HUMAN, RECOMBINANT, 3794
328000-1MG ERK ACTIVATION INHIBITOR PEPTIDE I, CELL 2507
328005-1MG ERK ACTIVATION INHIBITOR PEPTIDE II, CEL 3326
328006-5MG ERK INHIBITOR 1638
328007-1MG ERK INHIBITOR II *FR180204* 2591
328008-1MG ERK INHIBITOR II, NEG CONTROL *FR180289* 2507
328009-5MG ERK INHIBITOR III 1705
329600-5MG ERASTIN 2775
329815-25GM ERYTHROMYCIN, STREPTOMYCES ERYTHREUS 1939
329815-5GM ERYTHROMYCIN, STREPTOMYCES ERYTHREUS 736
329871-50UG ERYTHROPOIETIN, HU., RECOM, CHO CELL 1889
330005-1MG EST 1856
3301-1GM 17B-ESTRADIOL 870
330160-10MG ESTREN 4079
330175-1MG ECHINOMYCIN STREPTOMYCES SP. 2386
330200-100UG ECOTIN, E. COLI 2665
330655-750PMOL ESTROGEN RECEPTOR-A, HUMAN, RECOMBINANT 8834
330657-750PMOL ESTROGEN RECEPTOR-B, HUMAN, RECOMBINANT 8006
330658-200UL ANTI-ESTROGEN RECEPTOR MOUSE MAB (C-542) 4695
331569-1EA ETHIDIUM BROMIDE ADSORBER 1521
341006-25GM EDAC, HCL 2969
341006-5GM EDAC, HCL 1134
34103-500GM EDTA, TETRASODIUM SALT 1003
34115-5GM N-ETHYLMALEIMIDE 769
341180-100MG 2-ETHYL-2-THIOPSEUDOUREA, HBR 619
341205-25MG ETOPOSIDE 803
341207-5MG ET-18-OCH3 2164
341208-50UG EXOENZYME C3, CLOSTRIDIUM BOTULINUM 6786
341209-10MG EUK-8 1309
341214-5MG EXTRACELLULAR DEATH FACTOR PEPTIDE, NNWN 2591
341215-1MG EXOTOXIN A, PSEUDOMONAS AERUGINOSA 5239
341220-25MG EXO1 1822
341249-5MG FAAH INHIBITOR II 1104
341251-1MG FASCAPLYSIN, SYNTHETIC 1471
341262-250UG FACTOR B, HUMAN 4597
341272-2ML ANTI-FACTOR B GOAT PAB 2150
341273-25UG FACTOR D, HUMAN 4647
341274-250UG FACTOR H, HUMAN 5060
341276-1ML ANTI-FACTOR H GOAT PAB 1331
341280-250UG FACTOR I, HUMAN 5683
341282-50UG ANTI-FADD (125-140) RABBIT PAB 3049
341283-250UG FACTOR P, HUMAN 5683
341286-100UG ANTI-FARNESYL RABBIT PAB 4519
341289-100UG ANTI-FAS (29-44) RABBIT PAB 4695
341291-25MG FAS/FASL ANTAGONIST, KP7-6 4396
341292-10T PD ANTI-FAK (PTYR397) RABBIT PAB 6005
341298-1KIT FASTSILVER GEL STAINING KIT 3694
341305-25MG FASENTIN 2250
341310-5MG FABP4 INHIBITOR 2257
341380-25MG FENVALERATE 1020
341476-125MG FERRITIN, CHROMATOGRAPHICALLY-PURIFIED 4162
341476-25MG FERRITIN, CHROMATOGRAPHICALLY-PURIFIED 1053
341482-1MG FERRITIN, HUMAN LIVER 3326
341490-25UG FERRITIN, H-CHAIN, HUMAN, RECOMB. 5265
341491-25UG FERRITIN, L-CHAIN, HUMAN, RECOMB. 4680
341492-25MG FETPPS 1087
341501-10MG FETMPYP 1003
341506-1GM FETUIN, FETAL BOVINE SERUM 2274
341552-1ML ANTI-FIBRINOGEN RABBIT PAB 1532
341573-1GM FIBRINOGEN, BOVINE PLASMA 2474
341576-100MG FIBRINOGEN, HUMAN PLASMA 585
341576-1GM FIBRINOGEN, HUMAN PLASMA 3143
341578-500MG FIBRINOGEN, PLASMINOGEN-DEPLETED, PLASMA 1705
341583-25UG FIBROBLAST GROWTH FACTOR, BASIC, BOVINE 7939
341591-25UG FIBROBLAST GROWTH FACTOR, ACIDIC, RECOM 4413
341595-25UG FIBROBLAST GROWTH FACTOR, BASIC, RECOM 5382
341597-10UG FIBROBLAST GROWTH FACTOR-II, MO,REC. 3761
341598-10MG Fibroblast Growth Factor-2 Inhibitor, NSC37204  989
341600-200UG FIBRINOGEN, FRAGMENT D, HUMAN PLASMA 2140
341605-100UG FIBRINOGEN, FRAGMENT E, HUMAN PLASMA 1789
341607-5MG FGF/VEGF RECEPTOR TYROSINE KINASE INHIBI 3980
341608-5MG FGF RECEPTOR TYROSINE KINASE INHIBITOR 2173
341609-5MG FGFRECEPTORTYROSINEKINASEINHIBITORIV,NP6 2800
341610-5MG FGF/PDGF/VEGF RTK INHIBITOR 2137
341631-1MG FIBRONECTIN, BOVINE PLASMA 1271
341631-5MG FIBRONECTIN, BOVINE PLASMA 4998
341635-1MG FIBRONECTIN, HUMAN PLASMA 2207
341635-5MG FIBRONECTIN, HUMAN PLASMA 8190
341662-1MG FIBRINOPEPTIDE A, HUMAN 1488
341662-500UG FIBRINOPEPTIDE A, HUMAN 853
341664-1MG FIBRINOPEPTIDE B, HUMAN 1588
341668-500UG FIBRONECTIN, RAT PLASMA 3092
341691-250GM FICOLL 400 REAGENT, MB GRADE 10446
341691-25GM FICOLL 400 REAGENT, MB GRADE 1989
342000-1MG CASPASE INHIBITOR, NEGATIVE CONTROL 1438
342000-5MG CASPASE INHIBITOR, NEGATIVE CONTROL 5833
342001-10UG PROCATHEPSIN K, HU., RECOM 4663
342500-5MG FK-506 2303
343002-100UG ANTI-FLIP, C-TERMINAL (447-464) RB PAB 4037
343006-100UG ANTI-FLIPG/D (191-209) RABBIT PAB 4037
343009-50UG ANTI-VEGF RECEPTOR 3 RABBIT PAB 4607
343010-5UG FLT-3/FLK-2 LIGAND, HUMAN, RECOMBINANT 3260
343012-5UG FLT-3/FLK-2 LIGAND, MOUSE, RECOM 3260
343020-5MG FLT-3 INHIBITOR 2608
343021-1MG FLT3 INHIBITOR II 4579
343022-5MG FLT3 INHIBITOR III 2775
343023-5MG FLT3 INHIBITOR IV 2571
343209-5GM FLUORESCEIN DIACETATE 552
343210-1KIT FITC LABELING KIT 3943
34321-1GM FITC, ISOMER 1 2870
34321-250MG FITC, ISOMER 1 753
343222-1MG BIOTIN, FLUORESCEIN CONJUGATE 1856
343242-1MG FLUO 3/AM 4680
343250-100UG ANTI-FKBP59/HSP56 (441-458) RABBIT PAB 4973
343290-25MG FLUOXETINE, HYDROCHLORIDE 2875
343333-50MG 5-FLUORO-2'-DEOXYURIDINE 1004
343781-100UG W-CONOTOXIN GVIA 2691
343922-1GM 5-FLUOROURACIL 686
344034-250MG PPARG ACTIVATOR, FMOC-LEU 686
344036-1MG CFMSR TYROSINE KINASE INHIBITOR GW2580 2213
344037-1MG CFMS RECEPTOR INHIBITOR II 1475
344038-1MG CFMS RECEPTOR INHIBITOR III 1421
344039-5MG CFMS RECEPTOR INHIBITOR IV 2758
344041-1MG INSOLUTIONCFMSRECEPTORTYROSINEKINASEINHI 1640
344045-1ML FOCUS-PROTEASE ARREST COCKTAIL 3309
344050-50UG ANTI-FODRIN MOUSE MAB (FOD009) 4709
344075-10MG FLUPHENAZINE-N-2-CHLOROETHANE, DIHCL 1187
344079-100MG FLURBIPROFEN 719
344085-10UG FOLIMYCIN, STREPTOMYCES SP. 1605
344092-10MG Formin FH2 Domain Inhibitor, SMIFH2 889
344095-25MG FLUVASTATIN, SODIUM SALT 3326
344101-5MG FSB 3677
344145-100UG FPTASE, RAT, RECOMB., E. COLI 5633
344146-100UG FPTASE, GST-FUSION, HISTAG, RAT, RECOM 6953
344150-1MG FPT INHIBITOR I 2098
344152-1MG FPT INHIBITOR II 1471
344154-1MG FPT INHIBITOR III 1521
344198-250ML FORMALDEHYDE, MB GRADE 468
344205-500ML FORMAMIDE 1187
344206-100ML FORMAMIDE, MB GRADE 681
344206-1L FORMAMIDE, MB GRADE 2808
344215-5MG FORMONONETIN 1338
344216-5MG FORMYL PEPTIDE RECEPTOR-LIKE 1 AGONIST 3544
344220-5MG FORMYL PEPTIDE RECEPTOR-LIKE 1 ANTAGONIS 3627
344242-25UG FRACTALKINE, CHEMOKINE DOMAIN, RECOM 6268
344260-2.5MG FRACTION II, RABBIT RETICULOCYTES 4914
344270-10MG FORSKOLIN, COLEUS FORSKOHLII 2390
344270-25MG FORSKOLIN, COLEUS FORSKOHLII 5382
344270-50MG FORSKOLIN, COLEUS FORSKOHLII 8892
344273-10MG FORSKOLIN, 7-DEACETYL-7-METHYLPIPERAZINO 6602
344273-5MG FORSKOLIN, 7-DEACETYL-7-METHYLPIPERAZINO 4129
344275-1MG FORSKOLIN, 7-DEACETYL-7-O-HEMISUCCINYL- 1053
344277-1MG FORSKOLIN, 1,9-DIDEOXY-, COLEUS FORSKOHL 1572
344280-10UG FOSTRIECIN, STREPTOMYCES PULVERACEOUS 3293
344281-5MG FORSKOLIN, NKH477 2649
344289-1SET FREUND'S COMPLETE ADJUVANT, MODIFIED 2073
344291-10ML FREUND'S INCOMPLETE ADJUVANT, MODIFIED 468
344300-5MG SFRP-1 INHIBITOR 2137
344301-10MG sFRP Inhibitor II 2324
344342-1GM D-FRUCTOSE-6-PHOSPHATE, DISODIUM SALT 1739
344505-1MG FTASE SUBSTRATE, FLUOROGENIC 1455
344510-1MG FTASE INHIBITOR I 1956
344514-1MG FTASE INHIBITOR III 1872
344550-250UG FTI-276 2207
344555-1MG FTI-277 1984
344559-500UG FTI-2628 3560
344597-1MG FTY720 2691
344822-5MIU A1,2-FUCOSIDASE, XANTHOMONAS SP. 4697
344824-5MIU A1-3,4-FUCOSIDASE, XANTHOMONAS SP. 4597
344826-50MIU A1,6-FUCOSIDASE, C. MENINGOSEPTICUM 4697
344845-500UG FUMAGILLIN, ASPERGILLUS FUMIGATUS 1421
344847-250UG FUMITREMORGIN C, ASPERGILLUS. FUMIGATUS 2875
344850-1MG FUMONISIN B1, FUSARIUM MONILIFORME 1457
344852-1MG FUMONISIN B2, FUSARIUM MONILIFORME 2758
344905-1MG FURA2/AM 2825
344905-1SET FURA2/AM 3410
344905-250UG FURA2/AM 870
344905-5MG FURA2/AM 10363
344906-1ML FURA 2/AM IN SOLUTION 2691
344911-1SET FURA-PE3 AM 3744
344930-1MG FURIN INHIBITOR I 2198
344931-1MG FURIN INHIBITOR II 1672
344932-50UL FURIN, HUMAN, RECOMBINANT 5683
344935-5MG FURIN SUBSTRATE, FLUOROGENIC 3410
344945-10UG FYNT, HIS TAG, RECOMBINANT 6335
344960-5MG FUT-175 2641
345231-50UL ANTI-GABAA RECEPTOR G2-SUBUNIT RB PAB 4856
345250-20MG N-ACETYLLACTOSAMINE 2708
345386-10KU GLUCOSE OXIDASE, A. NIGER, RECOM 953
34539-1GM D(+)GALACTOSAMINE, HCL 870
3455-100GM D-GALACTOSE 1187
345510-2MG GALACTOSE BETA1,6-N-ACETYLGLUCOSAMINE 2357
345646-100MG A-D-GALACTOSE-1-PHOSPHATE, DIPOTASSIUM 1087
345670-20MG GALANTHAMINE, HBR 1388
345700-50MG GANCICLOVIR 2808
345701-25MG GAMBOGIC ACID, GARCINIA HANBURYI 2541
345717-25MG GANGLIOSIDE MIXTURE, AMMONI, BOV. BRAIN 3861
345724-1MG GANGLIOSIDE GM1, AMMONIUM, BOV. BRAIN 1271
345733-500UG GANGLIOSIDE GM3, MONOSIALO, BOV. MILK 7737
345736-1MG GANGLIOSIDE GD1A, DISIALO, DIAMMONIUM 1488
345742-1MG GANGLIOSIDE GD1B, DIASIALO, HUMAN BRAIN 4697
345743-500UG GANGLIOSIDE GD2, DISIALO, HUMAN BRAIN 5633
345744-1MG GANGLIOSIDE GT1B, TRISIALO, BOV. BRAIN 2207
345747-1MG GANGLIOSIDE GM1, ASIALO, HUMAN BRAIN 5182
345748-500UG GANGLIOSIDE GM4, MONOSIALO, HUMAN BRAIN 5666
345752-100UG GANGLIOSIDE GD3, DISIALO, DIAMMONIUM 1266
345752-1MG GANGLIOSIDE GD3, DISIALO, DIAMMONIUM 12537
345754-100UG GANGLIOSIDE GQ1B, TETRASIALO, TETRAAMMON 3243
345757-100UL ANTI-GANGLIOSIDE GM1 RABBIT PAB 6079
345758-100UL ANTI-GANGLIOSIDE GM1, ASIALO RABBIT PAB 3554
345759-100UL ANTI-GANGLIOSIDE GM2 RABBIT PAB 3554
345765-100UG ANTI-GAL4, DNA ACTIV DOMAIN MO MAB (5C8) 4636
345766-100UG ANTI-GAL4, DNA BINDING DOM MO MAB (8C-1) 4636
345787-25ML FLUORPRESERVE REAGENT 1254
345788-5MG B-GALACTOSIDASE, E. COLI 2274
345789-20ML FLUORSAVE REAGENT 966
345795-500U B1,3-GALACTOSIDASE, RECOMB., E. COLI 5081
345796-50ML GENAPOL X-080, PROTEIN GR. DET. 10% SOLN 1555
345797-25U A1-3,6-GALACTOSIDASE, RECOM 3293
345798-50ML GENAPOL X-100, PROTEIN GR. DET. 10% SOLN 1903
345802-1MG GC-GLOBULIN, MIXED TYPE, HUMAN PLASMA 2040
345804-2U B1-3,6-GALACTOSIDASE, RECOM 4413
345805-100UG GELDANAMYCIN, STREPTOMYCES HYGROSCOPICUS 3477
345806-50MIU B1,4-GALACTOSIDASE, S. PNEUMONIAE, RECOM 4597
345810-1GM G 418 SULFATE, CELL CULTURE TESTED 980
345810-250MG G 418 SULFATE, CELL CULTURE TESTED 585
345810-25GM G 418 SULFATE, CELL CULTURE TESTED 15661
345810-500MG G 418 SULFATE, CELL CULTURE TESTED 761
345810-5GM G 418 SULFATE, CELL CULTURE TESTED 3109
345811-50UL ENDO-BETA-GALACTOSIDASE, REC. 5817
345812-10ML G 418 SULFATE, CELL CULTURE TESTED 970
345812-20ML G 418 SULFATE, CELL CULTURE TESTED 1739
345812-50ML G 418 SULFATE, CELL CULTURE TESTED 3092
345814-1GM GENTAMYCIN SULFATE 1104
345815-20ML GENTAMYCIN SULFATE, STERILE-FILTERED 1455
345818-100ML RAPIDSTEP ECL REAGENT 3787
345830-100UG GALECTIN-3, HUMAN, RECOMBINANT, E. COLI 5716
345831-50UG GALECTIN-1, HUMAN, RECOMBINANT, E. COLI 4948
345832-100UG GALECTIN-3C, HUMAN, RECOMBINANT, E. COLI 8691
345834-20MG GENISTEIN, SOYBEAN 1421
345834-50MG GENISTEIN, SOYBEAN 2808
345836-5MG GENISTIN 1973
345852-50UG GERANYLGERANYLTRANSFERASEI,GST-FUSION,HI 5081
345855-50UG GGTASE II, RAT, RECOMB. 4179
345860-100UG ANTI-GFAP RAT MAB (2.2B10) 4651
345862-10MG GOLGICIDE A 1475
345868-5MG [6]-GINGEROL, ZINGIBER OFFICINALE 2056
345872-10UG GLIAL DERIVED NEUROTROPHIC FACTOR, RECOM 8388
345872-5UG GLIAL DERIVED NEUROTROPHIC FACTOR, RECOM 4246
345876-100GM BOVINE G-GLOBULIN, SERUM 9706
345876-25GM BOVINE G-GLOBULIN, SERUM 3521
345876-5GM BOVINE G-GLOBULIN, SERUM 853
345877-100MG CHICKEN G-GLOBULIN, SERUM 1187
345878-250UG GGTI-286 2274
345883-250UG GGTI-298 3234
345885-250UG GGTI-2147 2624
345886-1GM HUMAN G-GLOBULIN, SERUM 1053
345886-5GM HUMAN G-GLOBULIN, SERUM 4392
345887-5MG GINKGOLIC ACID (15:1) 3277
345991-1GM RABBIT G-GLOBULIN, SERUM 1120
345991-5GM RABBIT G-GLOBULIN, SERUM 4640
345996-100UG GLIAL FIBRILLARY ACIDIC PROTEIN, BRAIN 2775
346003-5MG GLUCAGON RECEPTOR ANTAGONIST II 2563
346006-5MG GLUCAGON-LIKE PEPTIDE 1 RECEPTOR AGONIST 2935
346021-5MG GLUCOKINASE ACTIVATOR, CPD A 1953
346100-5000U GLUCOCORTICOID RECEPTOR, HU., RECOM 7956
346101-5000U ANDROGENRECEPTOR,HISTAG,HU,RECOMBINANT 7956
346102-5000U PLK1, HIS TAG, HUMAN, RECOMBINANT, S. FR 6552
346104-10UG PLK2,GST-FUSION,HUMAN,RECOMBINANT,S.FRUG 4680
346106-10UG PLK3, HIS*TAG, HUMAN REC, S. FRUGIPERDA 4680
346110-25MG GLUCOCORTICOID RECEPTOR MODULATOR, CPDA 2307
346125-100GM D-GLUCONIC ACID, POTASSIUM SALT 853
346210-25MG B-GLUCAN, SACCHAROMYCES CEREVISIAE 2223
346299-100GM D(+)GLUCOSAMINE, HCL 569
346351-1KG D(+)GLUCOSE, ANHYDROUS 1237
346351-250GM D(+)GLUCOSE, ANHYDROUS 535
346764-1GM A-D-GLUCOSE-6-PHOSPHATE 753
346764-5GM A-D-GLUCOSE-6-PHOSPHATE 2257
346774-500U GLUCOSE-6-PHOSPHATE DEHYDROGENASE 970
347420-1MU BETA-GLUCURONIDASE {HELIX POMATIA} 4012
347425-500GM GLUCONOLACTONE 702
347436-5MG GGACK 2708
349254-5MG NS-398 2190
3510-100GM L-GLUTAMIC ACID 468
351800-2500U GOT, PORCINE HEART 1053
353905-50MG GLUTATHIONE MONOETHYL ESTER 1772
353919-1KIT GLUTATHIONE PEROXIDASE ASSAY KIT 7614
354102-100T GLUTATHIONE ASSAY KIT 9231
354103-1KIT GLUTATHIONE ASSAY KIT II 7614
354106-50UL ANTI-GLUTATHIONE RABBIT PAB 3613
3541-100GM GLUTATHIONE, REDUCED, FREE ACID 5683
3541-1GM GLUTATHIONE, REDUCED, FREE ACID 301
3541-25GM GLUTATHIONE, REDUCED, FREE ACID 1789
3541-5GM GLUTATHIONE, REDUCED, FREE ACID 652
354206-100UL ANTI-GST A1-1 RABBIT PAB 4797
354209-100UL ANTI-GST M1-1 RABBIT PAB 4739
354212-100UL ANTI-GST P1-1 RABBIT PAB 4797
3542-1GM GLUTATHIONE, OXIDIZED, FREE ACID 853
3542-5GM GLUTATHIONE, OXIDIZED, FREE ACID 2957
354400-500ML GLUTARALDEHYDE, 25% AQUEOUS SOLUTION 2222
354406-1MG GLUTAREDOXIN-S2, E. COLI</I> 7321
356310-1GM GLYBURIDE 903
356350-1000ML GLYCEROL 1287
356350-500ML GLYCEROL 753
356352-100ML GLYCEROL, MB GRADE 585
356352-1L GLYCEROL, MB GRADE 1388
35675-100GM B-GLYCEROPHOSPHATE, DISOD SALT, PENTAHYD 903
35675-250GM B-GLYCEROPHOSPHATE, DISOD SALT, PENTAHYD 1822
35675-50GM B-GLYCEROPHOSPHATE, DISOD SALT, PENTAHYD 585
356780-5GM GLYCYRRHIZIN, AMMONIUM SALT 1020
357002-100GM GLYCINE, MB GRADE 351
357002-1KG GLYCINE, MB GRADE 936
3570-1KG GLYCINE, FREE BASE 702
3570-500GM GLYCINE, FREE BASE 552
359960-600U GLUTATHIONE REDUCTASE, YEAST 3544
359963-1KIT GLUTATHIONE REDUCTASE ASSAY KIT II 7647
360512-1GM GLYCOCHOLIC ACID, SODIUM SALT 970
360512-5GM GLYCOCHOLIC ACID, SODIUM SALT 4028
361311-5GM GLYCODEOXYCHOLIC ACID, SODIUM SALT 2207
361507-1ML GLYCOGEN, MOLECULAR BIOLOGY GR., MUSSEL 2975
361515-1MG GLYCOGEN PHOSPHORYLASE INHIBITOR 1338
361515-5MG GLYCOGEN PHOSPHORYLASE INHIBITOR 4125
361523-10UG GSK3 ALPHA, GST-FUSION PROTEIN, HU, REC 4680
361524-100UG GSK 3BETA, HIS*TAG, HU.. RECOM 6268
361526-5KU GSK 3BETA-ISOZYME, RECOM E. COLI 5716
361527-1SET PD ANTI-GSK 3B (PSER9) MOUSE MAB (2D3) 4900
361528-100UG ANTI-GSK 3B, C-TERM (334-348) RABBIT PAB 4695
361530-1MG GSK-3B SUSBSTRATE 1338
361540-5MG GSK-3B INHIBITOR I 1488
361541-5MG GSK-3B INHIBITOR II 1672
361546-1MG GSK-3BETA PEPTIDE INHIBITOR 2307
361547-5MG GSK-3BETA INHIBITOR VI 1772
361548-5MG GSK-3B INHIBITOR VII 1555
361549-5MG GSK-3B INHIBITOR VIII **AR-A014418** 1605
361550-1MG GSK-3 INHIBITOR IX 1822
361551-1MG GSK-3 INHIBITOR X 1822
361552-500UG INSOLUTION(TM) GSK-3 INHIBITOR IX BIO 1337
361553-1MG GSK-3B INHIBITOR XI 2457
361554-1MG GSK-3B INHIBITOR XII, TWS119 1739
361554-5MG GSK-3B INHIBITOR XII, TWS119 5349
361555-1MG GSK-3 INHIBITOR XIII 1254
361555-5MG GSK-3 INHIBITOR XIII 3744
361556-1MG GSK-3 INHIBITOR IX, CONTROL, MEBIO 1739
361557-5MG INSOLUTION GSK-3&BETA INHIBITOR VIII 1605
361558-1MG GSK-3 INHIBITOR XV 4379
361559-5MG GSK-3 INHIBITOR XVI 3131
361561-1MG GSK-3 SUBSTRATE 3218
361562-5MG GSK-3B INHIBITOR XVIII 1883
362000-10MG N-GLYCOLYLNEURAMINIC ACID 3343
362180-5MIU N-GLYCOSIDASE A, ALMOND 4881
362185-100U N-GLYCOSIDASE F, C. MENINGOSEPTICUM 3510
362199-1MG A2-HS-GLYCOPROTEIN, HUMAN PLASMA 3925
362225-100UG B2-GLYCOPROTEIN 1, HUMAN PLASMA 4588
362280-1KIT GLYCOPROTEIN DEGLYCOSYLATION KIT 10134
362300-1SET N-GLYCOSIDASE F C MENINGOSEPTICUM, RECOM 4114
362309-5ML GLYCOSYLTRANSFERASE AFFINITY GEL-CDP 4849
362314-5ML GLYCOSYLTRANSFERASE AFFINITY GEL-UDP 4514
362338-5MG GLYCO-SNAP-1 3544
362339-5MG GLYCO-SNAP-2 1956
3630-100GM GLYCYLGLYCINE, FREE BASE 1455
3630-25GM GLYCYLGLYCINE, FREE BASE 535
364200-1MG GM 1489 1137
364200-5MG GM 1489 3744
364205-1MG GM 6001 1187
364205-5MG GM 6001 4023
364206-1MG INSOLUTION(TM) GM6001 1337
364210-1MG GM 6001, NEGATIVE CONTROL 1137
364210-5MG GM 6001, NEGATIVE CONTROL 3744
365250-1MG GO 6976 2649
365250-500UG GO 6976 2608
365251-500UG GO 6983 1722
365252-500UG GO 7874, HCL 2482
365253-1ML INSOLUTION(TM) GO 6976 2608
367222-1000IU GONADOTROPIN, PREGNANT MARE SERUM 919
367222-5000IU GONADOTROPIN, PREGNANT MARE SERUM 2782
368020-25MG GRAMICIDIN A, HIGH PURITY, B. BREVIS 4279
368043-10UG GRANZYME B, HUMAN, RECOMBINANT, E. COLI 5733
368044-10UG GRANZYME A, HUMAN, RECOMBINANT, E. COLI 5733
368046-10UG GRANZYME K, HUMAN, RECOMBINANT, E. COLI 5733
368050-1MG GRANZYME B INHIBITOR I 1287
368055-1MG GRANZYME B INHIBITOR II 1104
368056-1MG GRANZYME B INHIBITOR IV 1555
368057-5MG GRANZYME B SUBSTRATE I, COLORIMETRIC 2274
368059-1MG GRANZYME B SUBSTRATE II, FLUOROGENIC 769
368059-5MG GRANZYME B SUBSTRATE II, FLUOROGENIC 3026
368067-5MG GRANZYME B SUBSTRATE VIII, COLORIMETRIC 1672
368068-1MG GRANZYME B SUBSTRATE IX, FLUOROGENIC 970
368068-5MG GRANZYME B SUBSTRATE IX, FLUOROGENIC 2708
368620-1MG GROUP III CASPASE INHIBITOR I 5048
368662-200UG ANTI-GSK-3A/B MOUSE MAB (1H8) 3182
368673-50UL ANTI-GRP78 RABBIT PAB 3657
368975-100GM GUANIDINE THIOCYANATE 920
368975-500GM GUANIDINE THIOCYANATE 3744
369075-100GM GUANIDINE HCL, ULTROL GRADE 1187
369075-1KG GUANIDINE HCL, ULTROL GRADE 4279
369075-500GM GUANIDINE HCL, ULTROL GRADE 2357
369079-1KG GUANIDINE HYDROCHLORIDE 3243
369079-5KG GUANIDINE HYDROCHLORIDE 12067
369080-100GM GUANIDINE, HCL,MB GRADE 853
369080-1KG GUANIDINE, HCL,MB GRADE 6051
369334-5MG 2-GUANIDINOETHYLMERCAPTOSUCCINIC ACID 2658
370653-10MG PKNG INHIBITOR 1640
370654-1MG PROTEIN KINASE G INHIBITOR 1120
370655-1MG PKG IA INHIBITOR, CELL-PERMEABLE 1889
370656-50MG GUANOSINE 3',5'-CYCLIC MONOPHOSPHATE NA 987
370659-1ST ANTI-CGMP RABBIT PAB 4380
370660-10MG GUANOSINE, 3,5-CYCLIC PHOSPHATE, DIBUTYR 1338
370661-50UL ANTI-PROTEIN KINASE G RABBIT PAB 4826
370662-5UMOL GUANOSINE-3,5-CYCLIC PHOSPHATE 8-2AMINOP 4413
370664-10UMOL GUANOSINE 3,5-CYCLIC PHOSPHATE, B-PHENYL 7003
370665-25UMOL 8-PCPT-CGMP 5416
370667-5UMOL GUANOSINE 3,5-CYCLIC PHOSPHOTHIOATE SP- 4363
370668-10UMOL 2'-O-N-METHYLANTHRANILOYL-CGMP, SODIUM 3287
370674-5UMOL 8-BROMO-CGMPS, RP-ISOMER, SODIUM SALT 7989
370677-1UMOL 8-(4-CHLOROPHENYLTHIO)-CGMPS, RP-ISOMER 4012
370679-1UMOL GUANOSINE 3,5-CYCLIC PHOSPHOTHIOATE, PHE 2624
370680-5UMOL GUANOSINE 3,5-CYCLIC PHOSPHOTHIOATE, PHE 7872
370690-10MG Z-GUGGULSTERONE 1973
370690-25MG Z-GUGGULSTERONE 3928
370695-1MG GW1929 4881
370698-5MG GW7647 3722
370700-5MG GW9662 2-CHLORO-5-NITRO-N-PHENYLBENZAMID 1020
371450-100MG GDP-A-D-MANNOSE, DISODIUM SALT 3661
371450-10MG GDP-A-D-MANNOSE, DISODIUM SALT 836
371543-20MG GUANOSINE 5'-O-(2-THIODIPHOSPHATE) 3026
371545-10MG GUANOSINE 5'-O-(3-THIOTRIPHOSPHATE) 4396
371565-25MG GUANYLYL-5'-IMIDODIPHOSPHATE 9863
371701-250MG GUANOSINE 5'-TRIPHOSPHATE, DISODIUM SALT 3009
371701-50MG GUANOSINE 5'-TRIPHOSPHATE, DISODIUM SALT 753
371705-5MG GPR30 AGONIST, G-1 2223
371706-10MG GPR40 AGONIST 3042
371708-5MG GBETA,GAMMA MODULATOR II, GALLEIN 1505
371709-25MG GPR109B AGONIST 2137
371715-1MG GLIOTOXIN, GLADIOCLADIUM FIMBRIATUM 1555
371720-50UL ANTI-GIA-1-SUB INTERNAL (159-168) RB PAB 4900
371723-50UL ANTI-GIA-1/2-SUB(345-354,346-355) RB PAB 4973
371726-50UL ANTI-GIA-3/GOA-SUBUNITS (345-354) RB PAB 4783
371727-50UL ANTI-GIA-2-SUB, INTERNAL (85-100) RB PAB 4797
371728-50UL ANTI-GOA-SUBUNIT RABBIT PAB 4739
371729-50UL ANTI-GIA-3-SUB, C-TERM (345-354) RB PAB 4973
371730-50UL ANTI-GQA-SUBUNIT RABBIT PAB 4739
371731-50UL ANTI-GS ALPHA-SUBUNIT, RAT (RABBIT) 4739
371732-50UL ANTI-GSA-SUB, C-TERM (385-394) RB PAB 5833
371736-50UL G-PROTEINS, IB STD 5299
371737-50UL ANTI-GA-SUBUNIT, INTERNAL (40-54) RB PAB 4826
371738-50UL ANTI-GB-SUB, INTERNAL (127-139) RB PAB 4753
371739-50UG G-PROTEINS, BOVINE BRAIN, FUNCTIONAL 4380
371740-100UL ANTI-GT ALPHA-1-SUBUNIT, BOVINE (MOUSE) 4739
371751-50UL ANTI-GQA- AND G11A-SUB, C-TERM RB PAB 4973
371752-50UL ANTI-GQA-SUB, INTERNAL (115-133) RB PAB 4914
371754-50UL ANTI-GQA/G11A-SUB INTER (283-300) RB PAB 4900
371757-1KIT GSH/GSSG RATIO ASSAY KIT 16618
371764-150UL GSA-SUBUNIT,IB STD. 3076
371765-2UG GQA-SUB,HIS*TAG,RECOMB. 3159
371768-1250NG G-PROTEIN,B/G-SUBUNIT, BOVINE BRAIN 4613
371770-1ST G-PROTEIN SUBUNIT ANTIBODY SET 5578
371778-50UL ANTI-G12A-SUB, C-TERM (327-342) RB PAB 4724
371780-1MG GP ANTAGONIST-2A 2123
371783-50UL ANTI-G16A-SUB, C-TERM (360-373) RB PAB 4900
371795-5UG G-PROTEIN, BETA1 HU., GAMMA2, RECOM 7956
371806-5MG GTP-14564 1555
371813-50UL ANTI-GB-1-SUB, INTERNAL (26-39) RB PAB 4739
371817-50UL ANTI-GB3-SUB, INTERNAL (26-39) RB PAB 4739
371818-1MG G-PROTEIN BETAGAMMA BINDING PEPTIDE 1672
371818-5MG G-PROTEIN BETAGAMMA BINDING PEPTIDE 5533
371820-1MG G-PROTEIN BG BINDING PEPTIDE, MSIRK(L9A) 1605
371821-50UL ANTI-GBG-COMPLEX RABBIT PAB 4739
371847-50UL ANTI-GG-2-SUBUNIT RABBIT PAB 4739
371955-1MG H-7, DIHCL 1555
371955-5MG H-7, DIHCL 6084
371957-1MG ISOGRANULATIMIDE 3893
371958-1MG H-8, DIHCL 1555
371958-5MG H-8, DIHCL 6084
371959-100UG APOPTOSIS ACTIVATOR V, ISOAPOPTOLIDIN 3527
371962-1MG INSOLUTION(TM) H-89, DIHYDROCHL 1605
371963-1MG H-89, DIHCL 1605
371964-1MG HA 1004, DIHCL 1053
371970-1MG HA 1077, DIHCL 1404
371971-1SET HA14-1 4430
371971-2MG HA14-1 1003
372022-1MG HAPTOGLOBIN, MIXED TYPE, HUMAN PLASMA 1338
372770-1MG HBDDE 2574
373210-25MG HDL Receptor SR-BI Inhibitor, BLT-1 889
373225-5MG HDM2 E3 LIGASE INHIBITOR 1354
373260-5MG HEAT SHOCK PROTEIN INHIBITOR I 2056
373270-10MG HEC1/NEK2 MITOTIC PATHWAY INHIBITOR I 5949
373271-10MG HEC1/NEK2 MITOTIC PATHWAY INHIBITOR II 1256
373272-5GM HECAMEG 3410
373385-5MG HH SIGNALING ANTAGONIST VII, JK184 1421
373400-5MG HH/GLI ANTAGONIST, GANT58 2591
373401-5MG HH/GLI ANTAGONIST, GANT61 3023
373402-5MG HEDGEHOG ANTAGONIST VIII 2250
373500-1SET ANTI-HERG RABBIT PAB 3496
374001-500UG HELENALIN, ARNICA MONTANA 5098
374085-5MG HELSS 2324
374087-200UG ANTI-HEME OXYGENASE-1 MOUSE MAB (HO-1-1) 4114
374089-100UG ANTI-HEME OXYGENASE-1 RABBIT PAB 5666
374090-100UL ANTI-HEME OXYGENASE-1 (1-30) RABBIT PAB 4885
374094-100UG ANTI-HEME OXYGENASE-2 (21-50) RABBIT PAB 4885
374096-50UG EOSINOPHIL PEROXIDASE, HUMAN 6636
3741-5GM HEMIN CHLORIDE 1438
3745-5GM HEMOGLOBIN, BOVINE ERYTHROCYTES 1338
374805-1GM HEMOCYANIN, KEYHOLE LIMPET, SOLID 8491
374805-250MG HEMOCYANIN, KEYHOLE LIMPET, SOLID 2925
374805-50MG HEMOCYANIN, KEYHOLE LIMPET, SOLID 753
374806-500UL ANTI-KLH RABBIT PAB 1843
374807-250MG KLH, BES/MG2+ BUFFER 2842
374811-1GM KLH, MEGATHYRA CRENULATA 8491
374811-250MG KLH, MEGATHYRA CRENULATA 2925
374811-50MG KLH, MEGATHYRA CRENULATA 753
374813-25MG KLH, HIGH PURITY, EF, GLYCEROL 3510
374817-1GM HEMOCYANIN, KEYHOLE LIMPET, GLYCEROL 29788
374817-250MG HEMOCYANIN, KEYHOLE LIMPET, GLYCEROL 4255
374817-50MG HEMOCYANIN, KEYHOLE LIMPET, GLYCEROL 1094
374818-10MG HEMOCYANIN SUBUNITS, KEYHOLE LIMPET, EF 4998
374825-25MG KLH, MEGATHURA CRENULATA, HIGH PURITY 2441
374834-10GM HEMOGLOBIN, BOVINE ERYTHROCYTES 870
374858-100KU HEPARIN, LI , PORCINE INTESTINAL MUCOSA 836
375054-10MG HEPARIN, PORCINE INTESTINAL MUC, BIOTIN 2106
375095-100KU HEPARIN, NA , PORCINE INTESTINAL MUCOSA 853
375095-500KU HEPARIN, NA , PORCINE INTESTINAL MUCOSA 3026
375115-100UG HEPARIN COFACTOR II, HUMAN PLASMA 5068
375228-5UG HEPATOCYTE GROWTH FACTOR, HUMAN, RECOMB. 7137
375368-100ML HEPES, FREE ACID, ULTROL, 1M SOLN 1555
375368-500ML HEPES, FREE ACID, ULTROL, 1M SOLN 4480
375655-1GM N-HEPTYL-B-D-GLUCOPYRANOSIDE 1455
375670-100UG HERBIMYCIN A, STREPTOMYCES SP. 2842
376581-100MG 2-N-HEXADECANOYLAMINO-4-NO2 PHOSPHOCHOLI 1145
376650-5MG D-ERYTHRO-SPHINGOSINE, N-HEXANOYL- 1187
376811-2500IU HEXOKINASE, YEAST 1555
376816-1MG HEXOKINASE II VDAC BINDING DOMAIN PEPTID 3544
376817-100MG Hexokinase II Inhibitor II, 3-BP  490
376820-10MG BETA-HEXOSAMINIDASE INHIBITOR 2317
376965-1GM N-HEXYL-B-D-GLUCOPYRANOSIDE 1471
377853-2000U HIRUDIN, HIRUDO MEDICINALIS, RECOM 8306
3779-1GM HISTAMINE, FREE BASE 1106
3779-5GM HISTAMINE, FREE BASE 4498
377980-2MG HISPIDIN 3172
3810-100GM L-HISTIDINE, FREE BASE 1003
38205-250MG HISTONE, CALF THYMUS 1388
382061-100MG BISBENZIMIDE H 33258 FLUOROCHROME, 3HCL 3445
382061-1GM BISBENZIMIDE H 33258 FLUOROCHROME, 3HCL 29651
382061-250MG BISBENZIMIDE H 33258 FLUOROCHROME, 3HCL 10671
382065-100MG BISBENZIMIDE H 33342 FLUOROCHROME, 3HCL 1242
382110-10MG HISTONE ACETYLTRANSFERASE INHIBITOR II 2257
382120-25MG HISTONE ACETYLTRANSFERASE ACTIVATOR, CPB 2250
382129-500U HIV REVERSE TRANSCRIPTASE, RECOMB. 3861
382136-10000U HIV-1 PROTEASE, RECOMBINANT, E. COLI 6712
382148-5MG HISTONE DEACETYLASE INHIBITOR II 2257
382149-1MG HISTONE DEACETYLASE INHIBITOR III 1739
382149-5MG HISTONE DEACETYLASE INHIBITOR III 5282
382150-1MG HISTONE H1, CALF THYMUS 1287
382150-5MG HISTONE H1, CALF THYMUS 3878
382153-100UG ANTI-HDAC2 (475-488) RABBIT PAB 4446
382154-100UG ANTI-HDAC3 (415-428) RABBIT PAB 4446
382155-1MG HDAC SUBSTRATE, FLUOR. **MAL** 4229
382156-50UG PD ANTI-HISTONE H1 RABBIT PAB 3671
382157-50UG ANTI-HISTONE H3 RABBIT PAB 3730
382158-50UG ANTI-HISTONE H3, ACETYLATED RABBIT PAB 3730
382159-50UG PD ANTI-HISTONE H3 (PSER10) RABBIT PAB 3730
382160-50UG ANTI-HISTONE H4, ACETYLATED RABBIT PAB 3730
382161-50UG ANTI-HDAC4 (129-137) RABBIT PAB 3671
382162-50UG ANTI-HDAC5 (194-206, 536-545) RABBIT PAB 3671
382163-100UG ANTI-HDAC6 (1-16) RABBIT PAB 4666
382165-2ML HISTONE DEACETYLASE, RAT LIVER 5382
382169-5000U HDAC, HU., RECOM 6552
382170-10MG HISTONE DEACETYLASE INHIBITOR IV 3427
382172-10MG HISTONE DEACETYLASE INHIBITOR VI, HNHA 2800
382173-5MG HISTONE DEACETYLASE INHIBITOR VII, 106 2857
382174-50UG HISTONE DEACETYLASE 2, HIS*TAG, HU REC 6602
382176-50UG HISTONE DEACETYLASE 3/SMRT,HIS TAG, HU 6602
382178-5UG HISTONE DEACETYLASE 5, HIS*TAG, HU, REC. 5445
382180-50UG HISTONE DEACETYLASE 6, GST-FUSION,HU,REC 6602
382182-2UG HISTONE DEACETYLASE 7, GST-FUSION,HU,REC 6602
382184-50UG HISTONE DEACETYLASE 8, HIS*TAG, HUMAN RE 6602
382186-5UG HISTONE DEACETYLASE 9, HIS*TAG, HUMAN RE 6602
382190-5MG HISTONE LYSINE METHYLTRANSFERASE INHIBIT 2651
382425-10MG TREQUINSIN, HCL 3377
384620-10MG HONOKIOL 1939
385580-50UL ANTI-HSF1 RABBIT PAB 3203
385877-25UL ANTI-HSP25 RABBIT PAB 3028
385880-1MG HSP25 KINASE INHIBITOR 1689
385892-20UG HSP40, HUMAN, RECOMB., E. COLI 3360
385894-20UG HSP60, HUMAN, RECOMB., E. COLI 3360
385898-50UG HSP90, HUMAN 5311
385901-20UG HSP90ALPHA, HIS-TAG, HUMAN, RECOMBINANT 2541
385903-20UG HSP90BETA, HIS-TAG, HUMAN, RECOMBINANT 2541
385906-10MG HYALURONIC ACID, BOV. TRACH, FLUOR-LABEL 3570
385908-500MG HYALURONIC ACID, SODIUM 2624
385909-20UG HSP27, HIS-TAG, HUMAN, RECOMBINANT 2441
385910-100UG HYALURONIC ACID BINDING PROTEIN, BOV. 3661
385911-50UG HABP,BOVINE NASAL CARTILAGE,BIOTINYLATED 3510
385920-5MG HSP90 INHIBITOR, CCT018159 1705
385931-25KU HYALURONIDASE, BOVINE TESTES 4914
38594-100KU HYALURONIDASE, OVINE TESTES 2257
386011-50UG ANTI-HSP27 MOUSE MAB (G3.1) 3657
386013-50UL ANTI-HSP27 RABBIT PAB 3437
386020-25UL ANTI-HSP40 RABBIT PAB 3847
386023-50UG ANTI-HSP47 MOUSE MAB (M16.10A1) 3847
386028-50UG ANTI-HSP60 MOUSE MAB (LK-1) 4999
386029-100UG ANTI-HSP60 MOUSE MAB (LK-2) 2916
386032-50UG ANTI-HSP70 MOUSE MAB (C92F3A-5) 3715
386035-25UL ANTI-HSP70 RABBIT PAB 4113
386037-50UG ANTI-HSP70/HSC70 MOUSE MAB (N27F3-4) 3657
386040-50UG ANTI-HSP90 MOUSE MAB (AC88) 3715
386041-50UG ANTI-HSP90 RAT MAB (16F1) 3657
386043-50UG ANTI-HSP90A RAT MAB (9D2) 3437
386445-1KIT HYBRIDOMA SUBISOTYPING KIT, MOUSE 5145
386698-25MG HYDROCORTISONE, CHROMATOGRAPHIC STANDARD 1187
3867-1GM HYDROCORTISONE 903
386790-100ML HYDROGEN PEROXIDE 585
386790-500ML HYDROGEN PEROXIDE 1722
387000-100UL ANTI-5-HT1A-RECEPTOR GUINEA PIG PAB 4636
389561-100U HYALURONIDASE, S. HYALURONLYTICUS NOV. 1471
390238-25MG CAMPTOTHECIN, 10-HYDROXY- 1722
390582-1MG 8-HYDROXY-2'-DEOXYGUANOSINE 2491
390601-1MG A-HYDROXYFARNESYLPHOSPHONIC ACID 2641
390602-2MG HYDROXYFASUDIL 1638
390900-5MG 4-HYDROXYPHENYLRETINAMIDE 2140
391333-100GM HEPES, SODIUM SALT, ULTROL GRADE 1338
391333-1KG HEPES, SODIUM SALT, ULTROL GRADE 7806
391333-500GM HEPES, SODIUM SALT, ULTROL GRADE 4663
391334-100GM BES, FREE ACID, ULTROL GRADE 1455
391334-25GM BES, FREE ACID, ULTROL GRADE 585
391335-100GM BIS-TRIS, ULTROL GRADE 1488
391335-1KG BIS-TRIS, ULTROL GRADE 7939
391336-100GM BICINE, ULTROL GRADE 1087
391336-1KG BICINE, ULTROL GRADE 5691
391338-100GM HEPES, FREE ACID, ULTROL GRADE 1087
391338-1KG HEPES, FREE ACID, ULTROL GRADE 6235
391338-25GM HEPES, FREE ACID, ULTROL GRADE 502
391338-500GM HEPES, FREE ACID, ULTROL GRADE 4062
391338-5KG HEPES, FREE ACID, ULTROL GRADE 23967
391340-250GM HEPES, FREE ACID, MB GRADE 3042
391340-25GM HEPES, FREE ACID, MB GRADE 485
391753-1MG 8-HYDROXYGUANOSINE 1488
391947-100GM HYDROXYLAPATITE, FAST FLOW 2666
391947-500GM HYDROXYLAPATITE, FAST FLOW 8074
391948-100GM HYDROXYLAPATITE, HIGH RESOLUTION 2666
391948-500GM HYDROXYLAPATITE, HIGH RESOLUTION 9401
393204-1MG 4-HYDROXYNONENAL 1488
393206-100UL ANTI-HNE FLUOROPHORE RABBIT PAB 4768
393207-100UL ANTI-HNE-MICHAEL ADDUCTS, REDUCED RB PAB 5002
394111-100GM BIS-TRIS PROPANE, ULTROL GRADE 1989
39465-100GM TES, FREE ACID, ULTROL GRADE 1488
39465-1KG TES, FREE ACID, ULTROL GRADE 8374
394675-1KG TAPS, ULTROL GRADE 5533
39468-100GM TRICINE, ULTROL GRADE 953
39468-1KG TRICINE, ULTROL GRADE 6418
397100-5MG HNMPA-(AM)3 2106
399250-5MG N(G)-HYDROXY-L-ARGININE, MONOACETATE 1672
399275-1MG N(W)-HYDROXY-NOR-L-ARGININE, DIACETATE 652
399275-5MG N(W)-HYDROXY-NOR-L-ARGININE, DIACETATE 1588
399698-25GM 5-HYDROXY-L-TRYPTOPHAN, FREE ACID 4914
400001-100UL ANTI-IKBA RABBIT PAB 4783
400003-100UG ANTI-IKKG (400-416) RABBIT PAB 3817
400009-50UG I KAPPA B ALPHA,GST-FUSION,HU,REC,E.COLI 3761
400010-1MG CASPASE-1 INHIBITOR I 1104
400010-5MG CASPASE-1 INHIBITOR I 4530
400011-1MG CASPASE-1 INHIBITOR I, CELL-PERMEABLE 3159
400012-5MG CASPASE-1 INHIBITOR II 4012
400015-1MG CASPASE-1 INHIBITOR IV 1772
400025-5MG CASPASE-1 SUBSTRATE IV, COLORIMETRIC 1822
400046-5GM HYDROXYUREA 1221
400049-100TU HYGROMYCIN B, STREPTOMYCES SP. 552
400049-10MU HYGROMYCIN B, STREPTOMYCES SP. 10045
400049-1MU HYGROMYCIN B, STREPTOMYCES SP. 1488
400049-5MU HYGROMYCIN B, STREPTOMYCES SP. 5599
400050-100MG HYGROMYCIN B, STREPTOMYCES SP., CCT 652
400050-1GM HYGROMYCIN B, STREPTOMYCES SP., CCT 4079
400050-500MG HYGROMYCIN B, STREPTOMYCES SP., CCT 2591
400050-5GM HYGROMYCIN B, STREPTOMYCES SP., CCT 14090
400051-100KU HYGROMYCIN B, STREPTOMYCES SP. 753
400051-10MU HYGROMYCIN B, STREPTOMYCES SP. 16112
400051-1MU HYGROMYCIN B, STREPTOMYCES SP. 2340
400051-5MU HYGROMYCIN B, STREPTOMYCES SP. 9059
400052-20ML HYGROMYCIN B IN PBS, CELL CULTURE TESTED 2288
400052-50ML HYGROMYCIN B IN PBS, CELL CULTURE TESTED 4609
400052-5ML HYGROMYCIN B IN PBS, CELL CULTURE TESTED 2046
400053-20ML HYGROMYCIN B, IN 25 MM HEPES, CCT 2123
400053-5ML HYGROMYCIN B, IN 25 MM HEPES, CCT 652
400059-150UL PD ANTI-GLUR1 (PSER845) RABBIT PAB 3315
400060-50UG ANTI-GLUCOSE TRANSPORTER-1 RABBIT PAB 4095
400061-50UG ANTI-GLUCOSE TRANSPORTER-2 RABBIT PAB 4037
400062-50UG ANTI-GLUCOSE TRANSPORTER-3 RABBIT PAB 4037
400064-50UG ANTI-GLUCOSE TRANSPORTER-4 RABBIT PAB 4095
400068-150UL PD ANTI-GLUR1 (PSER831) RABBIT PAB 6128
400071-100UG HYPERFORIN 3276
400076-1MG HYPERICIN 1956
400080-100UL ANTI-HIF-1A MOUSE MAB (H1A67) 4797
400083-10MG HIF-1 INHIBITOR 1705
400087-10MG HIF-2A TRANSLATION INHIBITOR 1242
400089-10MG HIF-1ALPHA/2ALPHA INHIBITOR IV, FM19G11 1933
400090-5MG IC261 2324
400100-100UG ANTI-ICAD (2-21), N-TERMINAL RABBIT PAB 4212
400105-500UG HUMAN IGA1, PLASMA 2558
400109-500UG HUMAN IGA1, MYELOMA 2419
400110-500UG HUMAN IGA2, MYELOMA 2257
400120-2MG HUMAN IGG1, MYELOMA 2875
400122-2MG HUMAN IGG2, MYELOMA 2875
400124-1MG HUMAN IGG3, MYELOMA 2875
400126-1MG HUMAN IGG4, MYELOMA 3036
400140-1MG HUMANIN, HUMAN, SYNTHETIC 4680
400600-20MG L-N5-(1-IMINOETHYL)-ORNITHINE, DIHCL 1722
400995-2ML IMMUNOMAGNETIC BEADS 2992
400996-2ML STREPTAVIDIN COATED IMMUNOMAGNETIC BEADS 6092
401002-10UG IBERIOTOXIN, B. TAMULUS, RECOM 2223
401003-1GM (+/-)-IBUPROFEN 803
401006-1MG HYPOESTOXIDE, HYPOESTES ROSEA 2792
401020-250MG IMIQUIMOD 2407
4010-25GM HYPOXANTHINE 803
401098-2MG HUMAN IGA, PLASMA 1471
401103-5MG HUMAN IGG, F(AB')2, PLASMA 2758
401104-5MG HUMAN IGG, FC FRAGMENT, PLASMA 3671
401108-1MG HUMAN IGM, MYELOMA 1087
401111-5MG MOUSE IGG, SERUM 1739
401114-10MG HUMAN IGG, PLASMA 1471
401116-2MG HUMAN IGG, FAB FRAGMENT, PLASMA 4357
401122-1MG MOUSE IGG1, MYELOMA 3577
401123-1MG MOUSE IGG2A, MYELOMA 3636
401125-5ML GOAT ANTI-HUMAN IGA, A-CHAIN SPECIFIC 2062
401132-1ML ANTI-HUMAN IGA, ALPHA (GOAT) AL PH CONJ 2911
401135-2ML ANTI-HUMAN IGA, ALPHA-CHAIN (GOAT) POD 2150
401152-100UG HUMAN IGE, MYELOMA 4473
401164-100UG HUMAN IGD, MYELOMA PLASMA 3925
401207-2ML GT ANTI-MO IGG, G-CHAIN SPEC PEROX CONJ 2911
401211-1ML GT ANTI-MO IGG, H&L CHAIN SPECIFIC 1507
401212-1ML ANTI-MOUSE IGG, H&L (GOAT) ALK PHOS 2940
401213-2ML GT ANTI-MO IGG, H&L CHAIN SPEC BIO CONJ. 1624
401214-2ML GT ANTI-MO IGG, H&L CHAIN SPEC FITC CONJ 1624
401215-2ML GT ANTI-MO IGG, H&L CHAIN SPEC HRP CONJ. 2179
401216-2ML GT ANTI-MO IGG, H&L, BIO CONJ, ADSORBED 2487
401217-2ML GT ANTI-MO IGG, H&L CHAIN SPEC RHOD CONJ 1712
401219-2ML RB ANTI-MO IGG, H&L CHAIN SPEC FITC CONJ 1712
401225-2ML ANTI-MOUSE IGM, H&L (GOAT) POD 2179
401233-1ML GT ANTI-MO IGG, H&L F(AB')2 HRP CONJ. 3408
401244-1ML GT ANTI-MO IGG, H&L CHAIN SP FITC CONJ 2589
401245-2ML GT ANTI-MO IGG, H&L, RHOD CONJ, ADSORBED 2487
401250-100UG ILIMAQUINONE 2190
401253-2ML ANTI-MS IGG,H&L(GT)POD ADS BO,HO,HU 2867
401262-1ML RB ANTI-MO IGG, H&L, ALK PHOS CONJ 2911
401295-1ML ANTI-MOUSE IGM, H&L (GOAT) ALK PHOS CONJ 2911
401299-1ML GT ANTI-RB IGG, H&L CHAIN SP PE CONJ 3832
401311-1ML GT ANTI-RB IGG, H&L CHAIN SPECIFIC 1375
401312-1ML ANTI-RABBIT IGG, H&L (GOAT) ALK PHOS 2940
401313-2ML GT ANTI-RB IGG, H&L CHAIN SP BIO CONJ 1507
401314-2ML GT ANTI-RB IGG, H&L CHAIN SP FITC CONJ 1609
401315-2ML GT ANTI-RB IGG, H&L CHAIN SP HRP CONJ 2179
401319-2ML GT ANTI-RB IGG, H&L, FITC CONJ, ADSORBED 2487
401321-2ML GT ANTI-RB IGG, H&L CHAIN SP RHOD CONJ 1609
401352-1ML GT ANTI-RB IGG, H&L, APC, ADSORBED 3262
401353-2ML GT ANTI-RB IGG, H&L CHAIN SP HRP CONJ 2867
401355-2ML GT ANTI-RB IGG, H&L, TEXAS RED CONJ 1712
401371-1ML ANTI-RABBIT IGG, FC (GOAT) ALK PHOS CONJ 2911
401393-2ML GT ANTI-RB IGG, H&L CHAIN SP HRP CONJ 3218
401409-1ML GT ANTI-RT IGG, H&L CHAIN SPECIFIC APC 2911
401411-1ML GOAT ANTI-RAT IGG, H & L CHAIN SPECIFIC 1375
401414-2ML GT ANTI-RT IGG, H&L CHAIN SP FITC CONJ 1609
401416-2ML GT ANTI-RT IGG, H&L CHAIN SP HRP CONJ 2209
401432-500UL GT ANTI-HU IGG, H&L, F(AB')2, HRP CONJ 2019
401434-2ML GT ANTI-HU IGG, H-L CHAIN SP FITC CONJ 1609
401439-5ML GT ANTI-HU IGG, FC FRAGMENT SPECIFIC 1214
401441-1ML GOAT ANTI-HUMAN IGG, G-CHAIN SPECIFIC 1507
401442-1ML GT ANTI-HU IGG, G-CHAIN SPECIFIC APC 2940
401445-2ML ANTI-HUMAN IGG, GAMMA CHAIN (GOAT) POD 2179
401455-2ML ANTI-HUMAN IGG, H&L (GOAT) POD 2062
401459-250UG MO ANTI-HU IGG1, FC FRAGMENT SP APC 4695
401462-250UG MO ANTI-HU IGG2, FC FRAGMENT SP APC 4695
401465-250UG MO ANTI-HU IGG3, FC FRAGMENT SP APC 4636
401468-250UG MO ANTI-HU IGG4, FC FRAGMENT SP APC 4695
401474-1MG IKK INHIBITOR II, WEDELOLACTONE 1521
401477-1MG IKB KINASE INHIBITOR PEPTIDE, CELL-PERM. 3544
401478-1MG IKBK INACTIVE CONTROL PEPTIDE, CELL-PERM 3627
401479-1MG IKK-2 INHIBITOR, SC-514 1521
401480-1MG IKK INHIBITOR III, BMS-345541 3042
401481-500UG IKK-2 INHIBITOR IV 1605
401482-5MG IKK-2 INHIBITOR V, IMD-0354 3143
401483-1MG IKK-2 INHIBITOR VI 2257
401484-500UG INSOLUTION(TM) IKK-2 INHIBITOR IV 1605
401485-1MG INSOLUTION(TM) IKK-2 INHIBITOR, SC-514 1521
401486-1MG IKK INHIBITOR VII 2223
401487-1MG IKK-2 INHIBITOR VIII 2407
401488-5MG IKK-3 INHIBITOR IX 3126
401489-5MG IKK INHIBITOR X *PS-1145* 4028
401490-5MG IKK-2 INHIBITOR XI 4625
401491-5MG IKK INHIBITOR XII 2516
401493-1MG IKK INHIBITOR XIII, 17-AJB 1933
401504-2ML RB ANTI-GT IGG FC FRAG SPECIFIC HRP CONJ 2735
4015-100GM IMIDAZOLE, ULTROL GRADE 5583
401512-1ML RB ANTI-GT IGG, H&L CHAIN SPECIFIC APC 2925
401514-2ML RB ANTI-GT IGG, H&L CHAIN SP FITC CONJ 1726
401515-2ML ANTI-GOAT IGG, H&L (RABBIT) POD 2150
4015-25GM IMIDAZOLE, ULTROL GRADE 1989
401590-50MG RABBIT IGG, PLASMA 2123
401607-1ML GT ANTI-MO IGG, H&L B-GALACTOSIDASE CONJ 2589
401799-1MG HUMAN IGM, PLASMA 1471
401902-1ML ANTI-HUMAN IGM, MU CHAIN (GOAT) ALK PHOS 2940
401905-2ML GT ANTI-HU IGM, U-CHAIN SP. HRP CONJ. 2150
401954-1ML GOAT ANTI-HUMAN IGG, H&L CHAIN SPECIFIC 1287
402080-1MG INDANOCINE 2223
402081-1MG INDIRUBIN DERIVATIVE E804 1638
402085-1MG INDIRUBIN-3'-MONOXIME 2040
402086-1MG INDIRUBIN-3'-MONOXIME, 5-IODO- 1839
402087-5MG 7BIO 2591
402088-1MG INDIRUBIN-3'-MONOXIME-5-SULPHONIC ACID 1839
402096-1MG INDO 1/AM 2725
402096-1SET INDO 1/AM 4145
402100-2ML RB ANTI-SH IGG, H&L CHAIN SP HRP CONJ 2326
402104-2ML RB ANTI-SH IGG, H&L CHAIN SP. FITC CONJ 1712
402176-1EA IMMUNOPEN 1037
402334-1ML RABBIT ANTI-MOUSE IGG, H&L CHAIN SP. 2209
402335-2ML ANTI-MOUSE IGG, H&L (RABBIT) POD 2296
402412-20ML KANAMYCIN SULFATE, S. KANAMYCETICUS 2644
4041-25GM INDOLE-3-BUTYRIC ACID 1471
405200-100MG INDOLE-3-CARBINOL 1137
405268-10GM INDOMETHACIN 1421
4060-25GM INOSINE 736
4060-50GM INOSINE 1354
406170-5MG IP3K INHIBITOR 2207
4071-100GM MYO-INOSITOL 1087
407122-100UG D-MYO-INOSITOL 1,3,4-TRISPHOSPHATE, 6K 4329
407123-100UG D-MYO-INOSITOL 1,4,5-TRISPHOSPHATE, 3LI 1672
407123-1MG D-MYO-INOSITOL 1,4,5-TRISPHOSPHATE, 3LI 9611
407125-25MG D-MYO-INOSITOL HEXAKISPHOSPHATE 12NA 1872
407129-100UG D-MYO-INOSITOL 1,4,5-TRISPO4, 3DEOXY3-FL 1588
407135-10UG CAGED INS(1,4,5)P3, TRISODIUM SALT 2106
407135-1SET CAGED INS(1,4,5)P3, TRISODIUM SALT 13973
407137-1MG D-MYO-INOSITOL 1,4,5-TRISPHOSPHATE, 3NA 1789
407140-50UG ANTI-IP3 RECEPTOR MOUSE MAB (IPR.1) 4709
407141-1SET BT3(1,3,5)IP3/AM 8056
407143-100UG ANTI-IP3 RECEPTOR RABBIT PAB 4739
407207-1KIT SIGNALBOOST IMMUNOREACTION ENHANCER KIT 3056
407211-1BLOT INSTA-BLOT, HUMAN TISSUES 4530
407213-1BLOT INSTA-BLOT, RAT TISSUES 4530
407240-50UG INSULIN-LIKE GROWTH FACTOR-I, RECOM 6084
407241-50UG INSULIN DEGRADING ENZYME HIS, RAT, RECOM 3544
407245-50UG INSULIN-LIKE GROWTH FACTOR-II, RECOM 4430
407247-1MG IGF-1R INHIBITOR, PPP 1822
407248-10MG IGF-1R INHIBITOR II *PQ401* 2324
407251-100UG INSULIN-LIKE GROWTH FACTOR-I, HU, REC. 4931
407252-100UG INSULIN-LIKE GROWTH FACTOR-I, MOUSE, REC 3761
407253-20UG INSULIN-LIKE GROWTH FACTOR-I, RAT, RECOM 3761
407265-100UG ANTI-IP6 KINASE RABBIT PAB 4636
407271-5MG INTEGRIN ALPHA M BETA 2 LIGAND 1622
407286-100UG ANTI-INTEGRIN AV (AB-1 MO MAB (272-17E6) 3730
407290-500UG ANTI-A-INTERFERON MOUSE MAB (MMHA-2) 8846
407291-20KU ANTI-A-INTERFERON RABBIT PAB 5207
407293-100KU A-INTERFERON, MOUSE, RECOMB. 14983
407294-5MU AA-INTERFERON, HUMAN, RECOMB., E. COLI 6100
407295-50UG ANTI-A-IFN-R CHAIN 2 MO MAB (MMHAR-2) 5017
407299-20KU ANTI-B-INTERFERON RABBIT PAB 3232
407303-20UG G-INTERFERON, MOUSE, RECOMB., E. COLI 4914
407304-10UG G-INTERFERON, RAT, RECOMB., E. COLI 4630
407306-100UG G-INTERFERON, HUMAN, RECOMB. 5365
407307-20KU ANTI-B-INTERFERON RABBIT PAB 3964
407309-500UG ANTI-G-INTERFERON MOUSE MAB (MMHG-1) 5017
407310-500UG ANTI-G-INTERFERON RAT MAB (RMMG-1) 5017
407311-100UL ANTI-INTEGRIN AV (AB-5) MO MAB (313.6F8) 3671
407313-100UL ANTI-INTEGRIN AIIB MOUSE MAB (283.16B7) 3671
407314-100UL ANTI-INTEGRINB3 (AB-1) MO MAB (290.5C10) 3671
407316-100UL ANTI-INTEGRIN B5 MOUSE MAB (343.11D1) 3671
407317-100UL ANTI-INTEGRIN B6 MOUSE MAB (442.5C4) 3730
407318-10UG BETA-INTERFERON, HU., RECOM, CHO CELLS 5365
407318-2UG BETA-INTERFERON, HU., RECOM, CHO CELLS 2190
407320-100UG GAMMA-INTERFERON, MOUSE, RECOM 6151
407320-20UG GAMMA-INTERFERON, MOUSE, RECOM 2190
407321-100UG GAMMA-INTERFERON, RAT, RECOM 6151
407601-5MG IRAK-1/4 INHIBITOR 1572
407611-2UG INTERLEUKIN-1A, HUMAN, RECOMB. 4897
407613-5UG INTERLEUKIN-1A, MOUSE, RECOMB. 5533
407615-5UG INTERLEUKIN-1B, HUMAN, RECOMB. 5683
407616-10MG IL-1R ANTAGONIST 1271
407616-25MG IL-1R ANTAGONIST 2457
407617-5UG INTERLEUKIN-1B, MOUSE, RECOMB. 5683
407621-5MG IL-2RALPHA ANTAGONIST 2591
407623-10UG INTERLEUKIN-2, HUMAN, RECOMB. 5683
407629-10UG INTERLEUKIN-3, HUMAN, RECOMB. 4597
407631-10UG INTERLEUKIN-3, MOUSE, RECOMB. 5533
407637-10UG INTERLEUKIN-4, MOUSE, RECOMB. 5482
407652-10UG INTERLEUKIN-6, HUMAN, RECOMB. 5984
407653-25UG INTERLEUKIN-6 RECEPTOR, SOLUBLE, RECOM 7254
407654-5UG INTERLEUKIN-6, MOUSE, RECOMB. 5616
407670-1MG ANTI-INTERLEUKIN-6 RABBIT PAB 4826
407673-10UG INTERLEUKIN-8, HUMAN, RECOMB. 3677
407697-20UG B-INSULIN RECEPTOR KINASE, HU., RECOM 6669
407700-5UG INTERLEUKIN-10, HUMAN, RECOMB. 5683
407703-5UG IL-10, MOUSE, RECOMB. 5282
407705-5UG INTERLEUKIN-11, HUMAN, RECOMB. 5466
407706-10T PD ANTI-IR/IGF1R (PTYR1158) RABBIT PAB 5017
407707-10T PD ANTI-IR (PTYR1162/1163) RABBIT PAB 5104
407709-50MG INSULIN, HU., ZINC, RECOM, P. PASTORIS 2090
407710-25GM A-IODOACETAMIDE 1739
407711-5UG INTERLEUKIN-12, HUMAN, RECOMB. 6285
407715-5UG INTERLEUKIN-13, HUMAN, RECOMB. 6201
407719-25GM IODOACETIC ACID, SODIUM SALT 1638
407720-5UG INTERLEUKIN-15, HU., RECOM 4262
407721-10MG M-IODOBENZYLGUANIDINE, HEMISULFATE 1772
407850-5MG PARP INHIBITOR II, INH2BP 1053
407900-1MG 5-IODOTUBERCIDIN 2140
407950-10MG IONOMYCIN, FREE ACID, S. CONGLOBATUS 10981
407950-1MG IONOMYCIN, FREE ACID, S. CONGLOBATUS 1739
407950-5MG IONOMYCIN, FREE ACID, S. CONGLOBATUS 6235
407951-1MG IONOMYCIN, FREE ACID IN SOLUTION 1739
407952-10MG IONOMYCIN, CALCIUM , S. CONGLOBATUS 13468
407952-1MG IONOMYCIN, CALCIUM , S. CONGLOBATUS 1555
407952-25MG IONOMYCIN, CALCIUM , S. CONGLOBATUS 29003
407952-5MG IONOMYCIN, CALCIUM , S. CONGLOBATUS 5833
410957-1GM 3-ISOBUTYL-1-METHYLXANTHINE 2257
410957-250MG 3-ISOBUTYL-1-METHYLXANTHINE 870
411420-400UG MO ANTI-HU IGA, FAB FRAG SPECIFIC HP6123 2721
411423-400UG MOUSE ANTI-HUMAN IGA, SECRETORY, HP6141 2721
411427-400UG MO ANTI-HU IGG2, IGG3, IGG4 (HP6030) 2560
411451-400UG MO ANTI-HU IGG1, FC FRAG SP. (HP6069P) 2764
411452-200UL MO ANTI-HU IGG1, FC FRAG SP. (HP6069A) 1712
411455-400UG MO ANTI-HU IGG1, FC FRAG SP. (HP6070) 2633
411462-200UG MO ANTI-HU IGG2, FC FRAG SP.BIO CONJ. 2150
411466-400UG MO ANTI-HU IGG2, FD FRAG SP (HP6014) 2721
411483-200UG MO ANTI-HU IGG3, HINGE SP. BIO CONJ 2062
411492-400UG MO ANTI-HU IGG4, FC FRAG SP. (HP6025) 1530
411493-200UG MO ANTI-HU IGG4, FC FRAG SP. BIO CONJ 2150
411507-200UL MO ANTI-HU IGE, FC FRAG SP. (HP6029) 1712
411520-1ML GOAT ANTI-HUMAN IGE, E-CHAIN SPECIFIC 1273
411543-200UG MO ANTI-HU IGG1, FC FRAG SP. BIO CONJ 2150
411550-500UG MO ANTI-HU IGG, FC FRAG SP. HRP CONJ. 3569
412400-10MG IQ-1 3009
412500-1MG IRIPALLIDAL, IRIS PALLIDA 1889
412500-5MG IRIPALLIDAL, IRIS PALLIDA 7070
412520-25MG IRON CHELATOR, DP44MT 2982
4160-100GM L-ISOLEUCINE 1739
416157-1MG ISOHELENIN, INULA SP. 3410
416200-5MG DIPEPTIDYLPEPTIDASE IV INHIBITOR I 2274
419650-1MG ISOTETRANDRINE 1438
419700-25UG ISOPEPTIDASE T, RABBIT 5299
419800-5MG PARP INHIBITOR IV, IQD 1137
419840-25MG ITSA1 1471
420092-10T PD ANTI-JAK1 (PTYR1022/1023) RABBIT PAB 4900
420097-500UG INSOLUTION(TM) JAK INHIBITOR I 1588
420099-500UG JAK INHIBITOR I 1749
420101-5MG JAK3 INHIBITOR I 2274
420104-5MG JAK3 INHIBITOR II 2875
420107-50UG JASPLAKINOLIDE, JASPIS JOHNSTONI 4172
420108-100UG JNK SUBSTRATE, C-JUN 1-79 4363
420112-1MG JAK3 INHIBITOR, NEGATIVE CONTROL 2357
420114-100UL PD ANTI-C-JUN (PSER73) RABBIT PAB 4973
420115-1KIT JNK ACTIVITY IMMUNOASSAY KIT 10197
420116-1MG JNK INHIBITOR I, (L)-FORM, CELL-PERM. 4460
420118-1MG JNK INHIBITOR I, (L)-FORM, NEG CONTROL 1973
420119-25MG JNK INHIBITOR II (SP600125) 2649
420119-50MG JNK INHIBITOR II (SP600125) 3980
420119-5MG JNK INHIBITOR II (SP600125) 1237
420120-250MG JUGLONE 970
420121-10MG JAK3 INHIBITOR IV 3544
420122-10MG JAK3 INHIBITOR V 3126
420123-1MG JNK INHIBITOR II, NEGATIVE CONTROL 1053
420124-100UG JNK2A2, HIS-TAG, HUMAN, RECOMB., E. COLI 5950
420126-5MG JAK3 INHIBITOR VI 2140
420127-50UG INSOLUTION JASPLAKINOLIDE, J. JOHNSTONI 3939
420128-5MG INSOLUTION JNK INHIBITOR II (SP600125) 1394
420129-5MG JNK INHIBITOR V *AS601245* 2591
420130-1MG JNK INHIBITOR III, CELL-PERMEABLE 3326
420131-1MG JNK INHIBITOR III, CELL-PERM., NEG CONT 3226
420132-25MG JAK2 INHIBITOR II 1705
420133-2MG JNK INHIBITOR VI, TI-JIP 153-163 2240
420134-2MG JNK INHIBITOR VII, TAT-TI-JIP 153-163 3560
420135-5MG JNK INHIBITOR VIII 2975
420136-5MG JNK INHIBITOR IX 2507
420137-5UG JNK1, GST-FUSION, MO.,REC.,S. FRUGIPERDA 3494
420138-1EA INHIBITORSELECTJAK/STATSIGNALINGPATHWAYI 15654
420139-5MG JAK2 INHIBITOR IV 2930
420140-5MG JNK INHIBITOR X, BI-78D3 1309
420141-10MG JAK2 INHIBITOR V, Z3 1475
420142-10MG JNK INHIBITOR XI, BI-87G3 1465
420143-5MG JNK-3 INHIBITOR XII, SR-3576 1256
420145-25MG JAK3 Inhibitor VII, AD412  989
420200-5MG JC-1 4346
420210-1MG JERVINE 1772
420290-1GM IPTG, HEMIDIOXANE ADDUCT 669
420290-5GM IPTG, HEMIDIOXANE ADDUCT 2507
420291-1GM IPTG, ANIMAL-FREE, HIGH PURITY 870
420291-5GM IPTG, ANIMAL-FREE, HIGH PURITY 2407
420293-100UL ANTI-IRS-2 RABBIT PAB 4607
420297-100UG INSOLUTION(TM) K-252A, NOCARDIOPSIS SP. 2558
420298-100UG K-252A, NOCARDIOPSIS SP. 2558
420305-1MG K-252C 2792
420307-50UG KALLIKREIN, HUMAN PLASMA 3360
420311-25GM KAN SULFATE, STREPTOMYCES KANAMYCETICUS 3761
420311-5GM KAN SULFATE, STREPTOMYCES KANAMYCETICUS 970
420314-5MG KALLIKREIN SUBSTRATE, FLUOROGENIC 2491
420318-10MG KAINIC ACID 3243
420320-100UG KT5720 2390
420320-50UG KT5720 1471
420321-100UG KT5823 2691
420321-50UG KT5823 1555
420322-10GM IPTG, DIOXANE-FREE, HIGH PURITY 2892
420322-1GM IPTG, DIOXANE-FREE, HIGH PURITY 803
420322-25GM IPTG, DIOXANE-FREE, HIGH PURITY 6352
420322-5GM IPTG, DIOXANE-FREE, HIGH PURITY 2106
420323-50UG INSOLUTION(TM) KT5720 1637
420324-10MG KAINIC ACID, NATURAL 3026
420336-5MG KB-R7943 1939
420345-25MG KAEMPFEROL 1354
420355-100MG ISOPROTERENOL, HCL 468
420375-50UG KARYOPHERIN-B1, HU., RECOM 3928
420400-50UG ANTI-KDEL MOUSE MAB (10C3) 3715
420411-25GM KANAMYCIN SULFATE, S. KANAMYCETICUS, CCT 4329
420411-5GM KANAMYCIN SULFATE, S. KANAMYCETICUS, CCT 1137
420413-20ML POLYMYXIN B SULFATE, STERILE-FILTERED 2547
420600-50MG KETOCONAZOLE 1455
421050-5MG (Z-LL)2 KETONE 1354
421400-100UL ANTI-KDEL RECEPTOR MOUSE MAB (KR-10) 4709
421502-1SET ANTI-KV1.3 RABBIT PAB 2925
422000-1MG KENPAULLONE 1572
422175-5MG L-165,041 1939
422425-10UG KERATINOCYTE GROWTH FACTOR, HU., RECOM 5950
422500-1MG KIFUNENSINE, KITASATOSPORIA KIFUNENSE 3744
422686-1MG KININOGEN, HMW, SINGLE CHAIN, HU. PLASMA 6953
422688-1MG KININOGEN, HMW, TWO CHAIN, HUMAN PLASMA 6318
422690-10UG C-KIT,CYTOPLASMICDOM,HISTAG,HU,REC,S.FRU 6335
422706-1MG KN-62 1989
422708-1MG KN-93 1889
422708-5MG KN-93 6485
422709-1MG KN-92 1989
422711-1MG KN-93, WATER-SOLUBLE 1856
422712-1MG INSOLUTION(TM) KN-93 2023
422720-5MG L-744,832 2683
422751-100UL ANTI-ADAM10 (735-749) RABBIT PAB 3730
423500-50UG ANTI-KLOTHO RABBIT PAB 5489
426100-1MG LACTACYSTIN, SYNTHETIC 9305
426100-200UG LACTACYSTIN, SYNTHETIC 4563
426100-400UG LACTACYSTIN, SYNTHETIC 4646
426102-100UG CLASTO-LACTACYSTIN B-LACTONE 3811
426104-100UG ALPHA-METHYLOMURALIDE 3744
426205-500U B-LACTAMASE, BACILLUS CEREUS 569/H9 1187
426500-5MG B-LACTAMASE SUBSTRATE 2608
427211-50KU LACTATE DEHYDROGENASE, PORCINE HEART 2725
427217-25KU LACTATE DEHYDROGENASE, RABBIT MUSCLE 1705
427275-1KIT LACTOFERRIN ELISA KIT 14259
427489-100U LACTOPEROXIDASE, BOVINE MILK 619
427489-500U LACTOPEROXIDASE, BOVINE MILK 2507
427572-1MG LACTOSYL CERAMIDE, BOVINE 2758
427584-10GM LACTULOSE 468
427584-50GM LACTULOSE 1538
428010-5GM LAUROYLSARCOSINE, SODIUM SALT 2691
428015-1KG SODIUM N-DODECYL SULFATE 1120
428016-25GM SODIUM N-DODECYL SULFATE, HIGH PURITY 920
428017-100UG ANTI-LAMP1 MOUSE MAB (LY1C6) 4958
428018-200ML SDS, 20% SOLUTION (W/V) 1020
428019-200UL ANTI-LAMP2 RAT MAB (GL2A7) 4973
428020-1MG LATRUNCULIN B, LATRUNCULIA MAGNIFICA 2457
428021-100UG LATRUNCULIN A, LATRUNCULIA MAGNIFICA 3159
428023-500GM SDS, MB GRADE 4112
428023-50GM SDS, MB GRADE 576
428025-40UG A-LATROTOXIN, L. TREDECIMGUTTATUS 9347
428026-50UG INSOLUTION LATRUNCULIN A, L. MAGNIFICA 1939
428029-1EA SDS TABLETS 535
428033-100UL ANTI-CU2+-OXIDIZED LDL RABBIT PAB 4315
428035-100UL ANTI-HOCL-OXIDIZED LDL RABBIT PAB 4315
428040-20MG SDZ-201 106 (+/-) 1053
428150-1MG LAVENDUSTIN A 2190
428205-1MG LCK INHIBITOR 3058
428206-5MG LCK INHIBITOR II 3310
428207-5MG LCK INHIBITOR III 4746
428900-1KIT LCAT ACTIVITY ASSAY KIT, FLUOROMETRIC 7354
428901-1KIT CHOLESTEROL/CHOLESTERYL ESTER QUANT. KIT 6247
429415-100GM L-A-LECITHIN, SOYBEAN 3168
429700-1MG LEPTIN, HUMAN, RECOMB. 4296
429700-5MG LEPTIN, HUMAN, RECOMB. 12335
429705-1MG LEPTIN, MOUSE, RECOMB. 4246
429705-5MG LEPTIN, MOUSE, RECOMB. 12535
431005-50UG ANTI-LEPTIN RECEPTOR RABBIT PAB 4666
431050-5UG INSOLUTION TM LEPTOMYCIN B, STREPTOMYCE 4145
431525-100U L-LEUCINE DEHYDROGENASE, BACILLUS CEREUS 1488
431784-5MG LECTIN, PHA-L, PHASEOLUS VULGARIS 2106
431792-5MG LECTIN, SAMBUCUS NIGRA 2591
432077-5MG LEUHISTIN 3343
4330-100GM L-LEUCINE 870
434625-50UG LEUKOTRIENE B4 5416
434626-2MG LEWIS A TRISACCHARIDE 3778
434627-1ML ANTI-LEWIS A MOUSE MAB (T174) 4315
434629-1ML ANTI-LEWIS B MOUSE MAB (T218) 4534
434630-1MG LEWIS X TRISACCHARIDE 1772
434631-1ML ANTI-LEWIS X MOUSE MAB (P12) 4534
434634-2MG LEWIS Y TETRASACCHARIDE 3995
434636-1ML ANTI-LEWIS Y MOUSE MAB (F3) 4534
434692-50UG LEUKOTRIENE C4 6235
434729-100UG PROSTAGLANDIN H2 4012
434741-20MG ETYA 3778
435300-5MG LFM-A13 1822
435800-10MG LICOCHALCONE-A, SYNTHETIC 1187
435800-50MG LICOCHALCONE-A, SYNTHETIC 4346
436305-5GM LINOLEIC ACID 819
436390-50NMOL N-GLYCAN ACCEPTOR SUBSTRATE, DABSYLATED 5566
436416-20UG N-LINKED OLIGO, MAN-9 GLYCAN 5332
437600-1MG LPD-12 3661
437600-2MG LPD-12 6335
437620-5MG LIPOPOLYSACCHARIDE, E. COLI J5 3068
437621-50UG LIPOCORTIN-I, HIS*TAG FUSION 1455
437622-50UG LIPOCORTIN-II, HIS*TAG FUSION 1455
437625-5MG LIPOPOLYSACCHARIDE, E. COLI O55: B5 2906
437627-5MG LIPOPOLYSACCHARIDE, E. COLI O111: B4 2782
437628-1MG LIPOPOLYSACCHARIDE, S. MINNESOTA R595.. 4427
437629-5MG LIPOPOLYSACCHARIDE, S. MINNESOTA RE 595 3068
437632-1MG LIPID A, SALMONELLA MINNESOTA RE 595 3258
437639-1KIT LIPID HYDROPEROXIDE (LPO) ASSAY KIT 7647
437641-10MG LIPOPROTEINS, HIGH DENSITY, HUMAN PLASMA 2691
437644-10MG LIPOPROTEINS, LOW DENSITY, HUMAN PLASMA 2558
437647-5MG LIPOPROTEINS, VERY LOW DENSITY, PLASMA 2842
437650-5MG LIPOPOLYSACCHARIDE, S. TYPHIMURIUM 2906
437692-5GM A-LIPOIC ACID 973
437694-50MG DL-A-LIPOIC ACID, DIHYDRO- 1003
437695-100UL ANTI-LIPOIC ACID RABBIT PAB 4724
437704-5MG LIPOPROTEIN LIPASE ACTIVATOR NO-1886 1822
437707-100KU LIPASE, CHROMOBACTERIUM VISCOSUM 2257
437720-25UG LIPOXIN A4 4446
437725-25UG LIPOXIN A4, 15-EPI 4948
437996-500U 5-LIPOXYGENASE, HUMAN, RECOMBINANT 3895
438001-1EA ANTI-5-LIPOXYGENASE RABBIT PAB 4315
438002-250GM LITHIUM CHLORIDE, MB GRADE 803
438002-50GM LITHIUM CHLORIDE, MB GRADE 435
438185-25MG LOVASTATIN 1889
438186-5MG LOVASTATIN, SODIUM SALT 2708
438190-100UG ANTI-LRP, HEAVY CHAIN MOUSE MAB (8G1) 3657
438192-100UG ANTI-LRP, LIGHT CHAIN MOUSE MAB (5A6) 3657
438710-100UL ANTI-LRP (AB-1) MO MAB (LRP-56) 4519
4400-100GM L-LYSINE, HCL 435
4400-1KG L-LYSINE, HCL 1187
440025-5MG LUTEOLIN 1104
440154-100MG L-A-LYSOLECITHIN, EGG YOLK 1471
440165-10MG LXRALPHA/BETA AGONIST *GSK3987* 2691
440175-200UG ANTI-LXRA (318-329) RABBIT PAB 4446
440198-10MG LY 171883 1488
440202-10MG LY 294002 2649
440202-25MG LY 294002 3980
440202-5MG LY 294002 2092
440203-1MG LY 303511 1906
440204-1MG INSOLUTION(TM) LY 294002 978
440205-25MG LY 83583 4897
440205-5MG LY 83583 1287
440206-5MG LY 294002, 4'-NH2 3590
440208-5MG LY231617 2808
4403-1GM LYSOZYME, CHICKEN EGG WHITE 535
440345-100UG LYSOZYME, HUMAN NEUTROPHIL 1338
440345-1MG LYSOZYME, HUMAN NEUTROPHIL 7815
4403-5GM LYSOZYME, CHICKEN EGG WHITE 2270
441201-10KU MACERASE PECTINASE, RHIZOPUS SP. 1588
441201-50KU MACERASE PECTINASE, RHIZOPUS SP. 5984
441251-10MG A2-MACROGLOBULIN, HUMAN PLASMA 9377
441251-1MG A2-MACROGLOBULIN, HUMAN PLASMA 1421
441523-10UG MACROPHAGE INFLAMMATORY PROTEIN-1B, REC 5416
441850-100UG ANTI-MADD, C-TERM (1570-1588) RABBIT PAB 4037
442610-10KU MALATE DEHYDROGENASE, PORCINE HEART 1003
442611-100GM MAGNESIUM CHLORIDE, 6H2O, MB GRADE 452
442611-500GM MAGNESIUM CHLORIDE, 6H2O, MB GRADE 753
442615-500GM MAGNESIUM CHLORIDE, HEXAHYDRATE 753
442630-100MG GMBS 2670
442631-25MG MBB 2024
442675-100UG ANTI-MAP KINASE ERK1/2 (333-367) RB PAB 4753
442685-100UL PD ANTI-MAPK ERK1/2 (PT202/Y204) RB PAB 7531
442695-100UG ANTI-MAP 2 MOUSE MAB (M12) 4739
442704-200UL ANTI-MAP KINASE ERK1/ERK2 RABBIT PAB 4783
442706-1SET PD ANTI-MAPK ERK1/2 (PT202/Y204) MO MAB 4973
442710-100UL ANTI-MARCKS (PSER152/156) RABBIT PAB 5558
442711-50UL ANTI-MARCKS MOUSE MAB 3883
442730-50UL ANTI-MALONDIALDEHYDE RABBIT PAB 8021
443111-100GM MALTOSE, MONOHYDRATE 686
443300-500MG MCI-186 836
443713-5GM MALTOTRIOSE 3215
443907-100GM D(-)MANNITOL 468
443907-500GM D(-)MANNITOL 1455
4440-100GM D-MANNOSE 1471
444100-50MG D-MANNOSE-6-PHOSPHATE, DISODIUM SALT 920
444105-100UG ANTI-MAN 6-PHOS RECEPTOR MO MAB (2G11) 4432
444119-320U A1-2,3-MANNOSIDASE, X. MANIHOTIS, RECOM 4714
444125-100MIU A1,2-MANNOSYLTRANSFERASE, CAT. DOMAIN 3560
444143-1MG MDM2 ANTAGONIST, NUTLIN-3, RACEMIC 1572
444144-10MG MDM2 ANTAGONIST II, NSC 66811 2407
444145-10MG MDM2 INHIBITOR 1689
444146-10000U MDM2, HUMAN, REC., E. COLI 6552
444147-10000U HCV-NS3/4A PROTEASE, HU., RECOM 6552
444148-25UG WEST NILE VIRUS NS3 PROTEASE, REC. 5232
444151-1MG INSOLUTION NUTLIN-3, RACEMIC 1471
444168-50UL INSOLUTION(TM) MANT-GPPNHP 4246
444170-1MG MANUMYCIN A, STREPTOMYCES PARVULUS 1438
444180-1SET MAP KINASE INHIBITOR SET I 5650
444185-1SET MAP KINASE CASCADE INHIBITOR SET 5382
444189-1EA INHIBITORSELECTMAPKINASESIGNALINGPATHWAY 19905
444190-1SET MAP KINASE INHIBITOR SET II 4747
444200-1MG MDL-12,330A, HCL 719
444201-100GM D(+)MELEZITOSE, MONOHYDRATE 7136
444201-10GM D(+)MELEZITOSE, MONOHYDRATE 1921
444203-250ML B-MERCAPTOETHANOL, MB GRADE 786
444206-100UG ANTI-MCL-1 (121-139) RABBIT PAB 4695
444207-1MG MMP SUBSTRATE, FLUOROGENIC 2691
444208-5UG MMP-1 PROENZYME, HUMAN 2875
444209-500UL ANTI-MMP-1 RABBIT PAB 4457
444211-5MG MMP-1 SUBSTRATE I, FLUOROGENIC 2691
444212-1MG MMP-2 SUBSTRATE, FLUOROGENIC 3477
444213-5UG MMP-2 PROENZYME, HUMAN 2390
444215-5MG MMP-2/MMP-9 SUBSTRATE I, FLUOROGENIC 2691
444217-5UG MMP-3, CATALYTIC DOMAIN, HU., RECOM 4329
444218-5MG MMP-3 INHIBITOR I 3761
444219-1MG MMP-1 SUBSTRATE III, FLUOROGENIC 4329
444221-1MG MMP-1/MMP-9 SUBSTRATE, FLUOROGENIC 4329
444223-500UG MMP-3 SUBSTRATE II, FLUOROGENIC 4714
444224-5MG MMP-2/MMP-9 SUBSTRATE II 3861
444225-5MG MMP-3 INHIBITOR II 1572
444228-1MG MMP-7 SUBSTRATE, FLUOROGENIC 1772
444229-5UG MMP-8, HUMAN NEUTROPHIL 2875
444231-5UG MMP-9, MONOMER, HUMAN NEUTROPHIL 2140
444232-5UG MMP-9, DIMER, HUMAN NEUTROPHIL 1705
444233-5UG MMP-9-LIPOCALIN COMPLEX, HU. NEUTROPHIL 2390
444234-5UG MMP-9-LIPOCALIN-TIMP-1 COMPLEX, HU. NEUT 2875
444235-1MG MMP-13 SUBSTRATE, FLUOROGENIC 3477
444236-500UL ANTI-MMP-9 RABBIT PAB 4022
444237-1MG MMP-8 INHIBITOR I 1471
444239-5MG MMP-2/MMP-3 INHIBITOR I 2725
444241-5MG MMP-2/MMP-9 INHIBITOR I 2725
444244-10MG MMP-2 INHIBITOR I 1254
444247-1MG MMP INHIBITOR II 2140
444248-10UG MMP-13, PROENZYME, HISTAG, HU., RECOM 6736
444249-1MG MMP-2/MMP-9 INHIBITOR II 2140
444250-10MG MMP INHIBITOR I 2608
444251-1MG MMP-2/MMP-9 INHIBITOR III 2608
444252-1MG MMP-9/MMP-13 INHIBITOR I 1605
444255-1SET MMP INHIBITOR SET I 6335
444256-500UG MMP SUBSTRATE III, FLUOROGENIC 3694
444258-1MG MMP-14 SUBSTRATE I, FLUOROGENIC 2708
444264-1MG MMP INHIBITOR III 2040
444270-100UG MMP-7, ACTIVE, HU., RECOM 4831
444274-500UG MMP-2/MMP-9 INHIBITOR IV 2290
444278-500UG MMP-9 INHIBITOR I 1856
444279-1MG INNOZYME GELATINASE SUBSTRATE, FLUOR. 5482
444281-5MG MMP-3 INHIBITOR VIII 4735
444282-1MG MMP/TACE SUBSTRATE, FS-6 2741
444283-1MG MMP-13 INHIBITOR 1739
444284-5MG MMP-2/MMP-3 INHIBITOR III, PD166793 2240
444285-500UG MMP-2/MMP-9 INHIBITOR V 2491
444286-5MG MMP-2 INHIBITOR II 2691
444287-5UG MMP-13, HUMAN, RECOMBINANT, ACTIVE 4714
444288-5MG MMP-2 INHIBITOR III 3343
444289-5MG MARIMASTAT 2516
444290-2MG MMP INHIBITOR V 1972
444291-5MG MMP-12 INHIBITOR, MMP408 2909
444300-1GM MELATONIN 870
444324-10UG MARGATOXIN, RECOMB. 2969
444605-250UG MELITTIN 1287
444800-100MG MELOXICAM 2893
444805-10MG MEMBRANE TRAFFIC INHIBITOR, A5 2257
444810-1KIT PROTEOEXTRACT MEMBRANE PROT. EXTRCT. KIT 5481
444896-1MG MAS 7 2223
444898-1MG MASTOPARAN 2223
444904-100UG ANTI-MAST CELL CHYMASE MOUSE MAB (CC1) 4973
444905-100UG ANTI-MAST CELL TRYPTASE MOUSE MAB (AA1) 4168
444910-100UG ANTI-MAXI K+A (945-961) RABBIT PAB 4636
444930-5GM MEGA-9, ULTROL GRADE 5566
444934-5GM MEGA-10, ULTROL GRADE 4203
444937-1MG MEK INHIBITOR I 1772
444937-5MG MEK INHIBITOR I 6218
444938-5MG MEK INHIBITOR II 1471
444939-1MG MEK1/2 INHIBITOR 1555
444939-5MG MEK1/2 INHIBITOR 5466
444942-100UG ANTI-MEK1, N-TERMINAL (1-12) RABBIT PAB 4695
444955-100UL PD ANTI-MEK1/MEK2 (PSER218/222) RB PAB 5075
444965-5MG MEK1/2 INHIBITOR II 3009
444966-5MG MEK1/2 INHIBITOR III 1984
444967-5MG MEK1/2 INHIBITOR IV 1883
445800-25MG MERBARONE 1438
445821-5MG Meriolin 3  1847
445825-100MG DL-2-MERCAPTOMETHYL-3-GUANIDINOETHYLTHIO 1538
445865-1MG MGLUR5 LIGAND, CDPPB 1388
445870-100UL ANTI-MGLUR1A RABBIT PAB 5207
445874-5MG MGLUR5 ANTAGONIST, MTEP 1705
445885-250UG METASTIN, SYNTHETIC 3861
445888-1MG METASTIN (45-54) 1672
448101-1MG MET KINASE INHIBITOR *SU11274* 1622
448102-2MG MET KINASE INHIBITOR II 2090
448103-5MG MET/FLT-3/VEGFR2 TYROSINE KINASE INHIBIT 2965
4500-100GM L-METHIONINE 753
453710-1SET MEK INHIBITOR SET 3343
454125-100MG METHOTREXATE 1438
454180-10MG 2-METHOXYESTRADIOL 1018
454180-50MG 2-METHOXYESTRADIOL 3706
454202-10MG 8-METHOXYMETHYL-3-ISOBUTYL-1-METHYLXANTH 3842
454428-25MG METHYLUMBELLIFERYL-SULFO-N-AC-B-D-GLUCOS 1789
454454-50MG METHOXYSUC-ALA-ALA-PRO-VAL-P-NITROANILID 1488
454551-25MG (+/-)-METHOXYVERAPAMIL, HCL 1053
454565-1MG METHYL ARACHIDONYL FLUOROPHOSPHONATE 1438
454571-50UL PD ANTI-NMDA NR1 (PSER896) RABBIT PAB 3817
454575-100MG N-METHYL-D-ASPARTIC ACID 3026
454578-15UG ANTI-PAN-NMDA NR1 MOUSE MAB (R1JHL) 5265
454580-10UG ANTI-NMDAR 2A RABBIT PAB 5631
454582-10UG ANTI-NMDAR 2B RABBIT PAB 5631
454583-100UL PD ANTI-NMDA NR2B (PTYR1472) RABBIT PAB 5631
454584-10UG ANTI-PAN-NMDAR 2C RABBIT PAB 5558
454849-2.5UG MAPKINASE1,HISTAG,HU., REC,E.COLI 5148
454850-2000U MAP KINASE, MOUSE, RECOMB., E. COLI 4881
454854-5UG MAPKINASE 2,HISTAG,HU,REC, E. COLI 5148
454860-1MG MAPK SUBSTRATE, TYR HYDROXYLASE 24-33 3009
454861-5MG MNK1 INHIBITOR CGP57380 3260
454863-1MG D-ERYTHRO-MAPP 2591
454867-25MG MAPTAM 2842
455451-1GM ALBUMIN, BOVINE SERUM, METHYLATED 1187
457250-1GM METHYLENE BLUE 619
459616-25UG OKADAIC ACID, AMMONIUM SALT 1104
459618-50UG OKADAIC ACID, POTASSIUM SALT 1789
459620-25UG OKADAIC ACID, SODIUM SALT 1137
46202-100MG 1-METHYL-L-HISTIDINE 736
462040-5MG METHYLLYCACONITINE PERCHOLATE, DELPHINIU 1588
462711-100GM METHYL-A-D-MANNOPYRANOSIDE 1471
462711-25GM METHYL-A-D-MANNOPYRANOSIDE 569
466220-100MG S-METHYLISOTHIOUREA SULFATE 719
472804-10MG S-METHYL-L-THIOCITRULLINE, DIHCL 2274
474422-50MG METHYLUMBELLIFERYL-A-D-GALACTOPYRANOSIDE 2006
474426-100MG 4-METHYLUMBELLIFERYL-A-D-GLUCOPYRANOSIDE 1338
474427-100MG 4-METHYLUMBELLIFERYL-B-D-GLUCURONIDE 803
474431-1GM 4-METHYLUMBELLIFERYLPHOSPHATE, FREE ACID 1271
474500-5MG METHYLUMBELLIFERYL-N-AC-A-D-GLUCOSAMINID 1555
474502-250MG METHYLUMBELLIFERYL-N-AC-B-D-GLUCOSAMINID 1254
474700-50MG MEVASTATIN 1605
474705-5MG MEVASTATIN, SODIUM SALT 1789
474780-5MG MG-115 2758
474790-1MG MG-132 659
474790-20MG MG-132 3315
474790-5MG MG-132 1653
474791-1MG INSOLUTION(TM) MG-132 906
474791-5MG INSOLUTION(TM) MG-132 2649
474925-10MG MY-5445 2190
475250-1MG 4- 1287
475701-20UG MKK6, ACTIVE, HUMAN, REC., E. COLI 4998
475702-10UG MEK-1, ACTIVE, HUMAN, REC., E. COLI 4998
475720-500UL ANTI-MRP (QCRL-1) MOUSE MAB (QCLR-1) 6861
475723-500UL ANTI-MRP (QCRL-3) MOUSE MAB (QCRL-3) 4739
475730-10MG MRP1 Inhibitor II, Reversan 1488
475740-10MG MONOACYLGLYCEROL LIPASE INHIBITOR 1822
475800-1MG INSOLUTION(TM) ML 3163 1872
475814-25UG MICROCYSTIN-LF 2634
475815-500UG MICROCYSTIN-LR 3297
475816-250UG MICROCYSTIN-RR 3794
475818-25UG MICROCYSTIN-LW 2800
475820-10MG MITOMYCIN C, S. CAESPITOSUS 1718
475821-250UG INSOLUTION(TM) MICROCYSTIN-LR 2040
475822-10MG MITOPBN 2892
475823-100UG B2-MICROGLOBULIN, HUMAN URINE 1137
475823-250UG B2-MICROGLOBULIN, HUMAN URINE 2474
475828-1MG B2-MICROGLOBULIN, HU., RECOM 8107
475837-5MG MIF ANTAGONIST, ISO-1 1521
475838-50MG MIFEPRISTONE 1053
475840-10MG MILRINONE 3260
475841-50MG MILTEFOSINA 1287
475842-500MG L-MIMOSINE 2563
475843-50MG MINOCYCLINE, HCL 903
475855-1R MIRACLOTH 1186
475856-10MG MITOCHONDRIAL DIVISION INHIBITOR,MDIVI-1 1475
475861-5UG MAPKAPK 2, GST-FUSION PROTEIN, RECOM 2250
475862-5UG MAPKAPK3, GST-FUSION PROTEIN, RECOM 2875
475863-5MG MK2A INHIBITOR 3042
475864-5MG MK-2 INHIBITOR III 3092
475866-1KIT MITOCAPTURE APOPTOSIS DETECTION KIT 8586
475867-25MG MN-CPX 3 2033
475870-25MG MNTBAP 1020
475872-25MG MNTMPYP 1020
475874-5MG MK571, SODIUM SALT 1555
475876-1SET MITOCHONDRIAL PERMEABILITY PORE REAG SET 10433
475877-5MG MITOCHONDRIAL CTP INHIBITOR 1381
475878-10MG (+)-MK 801 MALEATE 1477
475879-1MG MONASTROL 1237
475879-5MG MONASTROL 3878
475880-1MG ML-7, HCL 1906
475882-1MG ML-9, HCL 1839
475886-100MG N(G)-MONOMETHYL-L-ARGININE, MONOACETATE 4045
475886-25MG N(G)-MONOMETHYL-L-ARGININE, MONOACETATE 1254
475886-50MG N(G)-MONOMETHYL-L-ARGININE, MONOACETATE 2207
475889-5MG MK-886 1689
47589-2MG MITOMYCIN C, STREPTOMYCES CAESPITOSUS 1851
475893-100GM MES, FREE ACID, ULTROL GRADE 1104
475893-1KG MES, FREE ACID, ULTROL GRADE 7655
475893-500GM MES, FREE ACID, ULTROL GRADE 4914
475894-100GM MES, SODIUM SALT, ULTROL GRADE 1338
475894-1KG MES, SODIUM SALT, ULTROL GRADE 8758
475895-250MG MONENSIN, SODIUM SALT, HIGH PURITY 1872
475897-100MG MONENSIN METHYL ESTER 1806
475898-100GM MOPS, FREE ACID, ULTROL GRADE 1087
475898-1KG MOPS, FREE ACID, ULTROL GRADE 5683
475898-500GM MOPS, FREE ACID, ULTROL GRADE 3895
475899-100GM MOPS, SODIUM SALT, ULTROL GRADE 1338
475899-1KG MOPS, SODIUM SALT, ULTROL GRADE 8407
475901-10UG MONOCYTE CHEMOTACTIC PROTEIN-1, RECOM 4814
475904-100GM MOWIOL 4-88 REAGENT 1287
475906-25MG THIOLYTE MC 2631
475911-100UG MYELOPEROXIDASE, POLYMORPHONUCLEAR LEUKO 1872
475913-100MG MYCOPHENOLIC ACID 1287
475913-500MG MYCOPHENOLIC ACID 4897
475914-1GM NYSTATIN, STREPTOMYCES NOURSEI 619
475914-5GM NYSTATIN, STREPTOMYCES NOURSEI 2324
475915-1ML ANTI-MYELOPEROXIDASE RABBIT PAB 2106
475916-100ML MOPS/EDTA BUFFER, 10X LIQUID CONCENTRATE 1087
475919-1KIT MYELOPEROXIDASE ELISA KIT 13772
475920-1MG MYELIN BASIC PROTEIN SUBSTRATE 3694
475921-50MG NYSTATIN, S. NOURSEI, STERILE, TC GR. 652
475922-100GM MOPS, FREE ACID, MB GRADE 1120
475923-1ST ANTI-MUSCARINIC M1 ACH RECEPTOR RB PAB 2383
475924-1ST ANTI-MUSCARINIC M2 ACH RECEPTOR RB PAB 2250
475926-1MG MYOGLOBIN, HUMAN, RECOMB., E. COLI 4329
475927-1MG [NLE13]-MOTILIN 2591
475935-10UG MT1-MMP, CATALYTIC DOMAIN, HU., RECOM 6469
475937-10UG MT1-MMP,SOLUBLEPROENZYME,HISTAG,HU,REC,E 6268
475938-10UG MT2-MMP, CATALYTIC DOMAIN, HU., RECOM 6301
475939-10UG MT3-MMP, CATALYTIC DOMAIN, HU., RECOM 6268
475940-10UG MT4-MMP, CAT. DOMAIN, HIS, HU., RECOM 6535
475941-1KU MYOKINASE, YEAST 920
475944-1GM MYELOPEROXIDASE INHIBITOR I 903
475948-100UG ANTI-MUNC-18 (58-70) RABBIT PAB 4446
475950-10MG MPV(PIC) 2190
475951-25MG MREB PERTURBING COMPOUND A22 1705
475954-10MG MRN-ATM PATHWAY INHIBITOR, MIRIN 1640
475956-10MG C-MYC INHIBITOR 1689
475957-10MG  c-Myc Inhibitor II  789
475980-1MG MYOSEVERIN 753
475981-5MG MLCK INHIBITOR PEPTIDE 18 2992
475987-10UG MTOR, HUMAN, RECOMBINANT, S. FRUGIPERDA 12778
475988-5MG MTOR INHIBITOR III, PP242 1799
475989-10GM MTT 7254
475989-1GM MTT 1137
476125-50UG MYOSIN REGULATORY LIGHT CHAIN-2, HIS 1455
476126-500UL ANTI-MYOSIN RABBIT PAB 3803
476275-25MG MYRICETIN 1254
476300-5MG MYRIOCIN, MYCELLA STERILIA 2006
476475-500UG PKC INHIBITOR, EGFR FRAGMENT, MYRISTOYL 1939
476480-500UG PKC INHIBITOR 20-28, CELL-PERM, MYRISTOL 1906
476485-500UG PKA INHIBITOR 14-22, CELL-PERM, MYRISTOL 1605
476490-1SET PROTEIN KINASE INHIBITOR SET 5950
476493-50MG PROTEIN KINASE INHIBITOR, DMAP 903
476495-10MG PKD Inhibitor, CID755673 2909
476880-5MG NALTRINDOLE, HYDROCHLORIDE 1605
479775-5GM A-NAPHTHYL ACID PHOSPHATE, MONOSOD. SALT 1003
479830-5MG NBI-31772 1906
479975-250MG NDGA 853
480001-25GM NDSB-195 5014
480001-5GM NDSB-195 1455
480005-250GM NDSB-201 3878
480005-25GM NDSB-201 736
480010-25GM NDSB-256 5014
480010-5GM NDSB-256 1438
480012-1SET NDSB SET 3861
480014-25GM NDSB-221 4881
480014-5GM NDSB-221 1471
480022-25MG NEMADIPINE-A 2591
480025-500UG NEMO-BINDING DOMAIN PEPTIDE, CELL-PERM. 3159
480030-500UG NEMO-BINDING DOMAIN BINDING PEPTIDE, NEG 3059
480060-5MG NECROSIS INHIBITOR, IM-54 2591
480065-5MG NECROSTATIN-1 1521
480066-5MG NECROSTATIN-1, INACTIVE CONTROL 1521
480100-20ML NEOMYCIN SULFATE, TISSUE CULTURE GR. 1053
4801-25GM NEOMYCIN SULFATE 602
480150-5MG RAS-NET (ELK-3) PATHWAY INHIBITOR, XRP44 1546
480275-100UG B-NERVE GROWTH FACTOR, HUMAN, RECOMB. 5014
480352-10UG 2.5S NGF, MOUSE SUBMAXILLARY GLANDS 2842
480354-100UG 7S NGF, MOUSE SUBMAXILLARY GLANDS 2842
480400-10MG NF007 2608
480401-1MG NFAT INHIBITOR, CELL-PERMEABLE 4507
480402-500UG NFAT INHIBITOR 1672
480403-5MG NFAT ACTIVATION INHIBITOR III, *INCA-6* 1739
480415-10MG NF023 3243
480418-5MG NF 279 2274
480420-10MG NF449 3300
480450-1MG NFF-2 3477
480703-10MG NEURODAZINE 2572
480706-50MIU A2,3-NEURAMINIDASE, M. DECORA, RECOM 1772
480708-500MIU A2-3,6-NEURAMINIDASE, C. PERFRINGENS 4597
480716-250MIU A2-3,6,8,9-NEURAMINIDAS, RECOMBINANT 4597
480732-50UG NEURON SPECIFIC ENOLASE, HUMAN BRAIN 1722
480734-1ML ANTI-NEURON SPECIFIC ENOLASE RABBIT PAB 4592
480738-100UL ANTI-NEUROKININ-1 RECEPTOR RABBIT PAB 4739
480739-150UL ANTI-NEUROKININ-3 RECEPTOR, RAT (RABBIT) 4853
480741-250U CLEAVED CDK5 ACTIVATOR, P35, BOV., RECOM 4513
480743-10MG NEURONAL DIFFERENTIATION INDUCER III 2634
480745-5MG NEUROPATHIAZOL 2741
480875-10UG NEUROTROPHIN-3, HUMAN, RECOMB. 5767
480875-5UG NEUROTROPHIN-3, HUMAN, RECOMB. 4246
481001-1ML ANTI-NEUTROPHIL ELASTASE RABBIT PAB 1653
481404-10UG IKKB,HISTAG&STAG,HUREC,S.FRUGIPERDA 5850
481404-2.5UG IKKB,HISTAG&STAG,HUREC,S.FRUGIPERDA 1438
481406-1MG NF-KAPPAB ACTIVATION INHIBITOR 1521
481407-1MG INSOLUTION NF-KB ACTIVATION INHIBITOR 1521
481408-5MG NF-KB ACTIVATION INHIBITOR II, JSH-23 2274
481409-10UG PTEN, HIS*TAG AND S*TAG, HUMAN REC., SP. 5850
481411-5MG NF-KAPPA B ACTIVATION INHIBITOR III 2106
481412-10MG NF-KB ACTIVATION INHIBITOR IV 2240
481413-10UG AURORA A, HIS*TAG AND S*TAG, HUMAN REC., 4897
481414-5MG NF-KB ACTIVATION INHIBITOR VI, BOT-64 3667
481480-500UG NF-KB SN50, CELL-PERM. INHIBITOR PEPTIDE 2825
481486-500UG NF-KB SN50M, INACTIVE CONTROL PEPTIDE 2825
481487-1EA INHIBITORSELECTNF-KBSIGNALINGPATHWAYINHI 18967
481490-10MG NGB 2056
481905-100UL ANTI-NICASTRIN, C-TERM (689-709) RB PAB 4783
481906-100UL ANTI-NICASTRIN, N-TERM (62-93) RB PAB 4783
481907-100GM NICOTINAMIDE 535
481911-10GM NAD, FREE ACID 5048
481911-5GM NAD, FREE ACID 2959
481913-1GM NADH, DISODIUM SALT 1354
481913-500MG NADH, DISODIUM SALT 920
481915-1GM NAD, LITHIUM SALT 1137
481918-100GM NICOTINIC ACID 730
481919-25MG NAADP RECEPTOR MODULATOR 2407
481925-5U NADH OXIDASE, BACILLUS LICHENFORMIS 4530
481971-100MG NADP, MONOSODIUM SALT 753
481971-1GM NADP, MONOSODIUM SALT 3845
481971-500MG NADP, MONOSODIUM SALT 2457
481971-5GM NADP, MONOSODIUM SALT 13187
481972-100MG NADP, DISODIUM SALT 769
481972-1GM NADP, DISODIUM SALT 3945
481973-100MG NADPH, TETRASODIUM SALT 1872
481973-1GM NADPH, TETRASODIUM SALT 11666
481973-25MG NADPH, TETRASODIUM SALT 803
481973-500MG NADPH, TETRASODIUM SALT 6586
481973-50MG NADPH, TETRASODIUM SALT 1338
481974-200UG NADPH-P450 OXIDOREDUCTASE, HU., RECOM 5884
481975-100MG (-)-NICOTINE DITARTRATE 619
481978-500UL ANTI-NIDOGEN RABBIT PAB 3803
481981-250MG NIFEDIPINE 953
481984-500MG NIFUROXAZIDE 1309
481990-10MG NIGERICIN 1455
481990-5MG NIGERICIN 903
482100-10MG L-NIL, DIHCL 2190
482200-25MG NIMODIPINE 819
482210-5MG NIMESULIDE ANALOG, COMPOUND 76 2909
482251-1UG NIPP-1, HISTAG, BOV. THYMUS, RECOM 1772
482650-1KTT NITRIC OXIDE ASSAY KIT, COLORIMETRIC 6243
482655-1KIT NO ASSAY KIT, FLUOROMETRIC 5657
482675-1SET NITRIC OXIDE DONOR SET 4981
482680-1SET NITRIC OXIDE DONOR SET II, NONOATES 5950
482700-1KTT NITRIC OXIDE SYNTHASE ASSAY KIT 6243
482702-1KIT NOS ASSAY KIT, COLORIMETRIC 5657
482721-50U NOS, CONSTITUTIVE, RAT NEURONAL, RECOM 4028
482722-10U NOS, CONSTITUTIVE, RAT NEURONAL, RECOM 4814
482728-100UL ANTI-INOS (1131-1144) RABBIT PAB 5002
482732-10U NOS, ENDOTHELIAL, BOV., RECOM 5382
482736-100UL ANTI-NITRIC OXIDE SYNTHASE N-TERM RB PAB 4753
482737-100UG PD ANTI-ENOS (PSER1177) MOUSE MAB (15E2) 4900
482755-200UL ANTI-INOS, C-TERM (SLEMSAL) RABBIT PAB 4724
482777-50U NITRIC OXIDE SYNTHASE, INDUCIBLE, RECOM 6051
483120-100MG N(G)-NITRO-L-ARGININE 602
483125-100MG N(G)-NITRO-L-ARGININE METHYL ESTER, HCL 619
483400-100MG 7-NITROINDAZOLE 1538
484100-10MG NPPB 1187
484235-1GM P-NITROBLUE TETRAZOLIUM CHLORIDE 2491
484235-250MG P-NITROBLUE TETRAZOLIUM CHLORIDE 702
484400-5MG NITROCEFIN 1521
487052-1GM P-NITROPHENYL-N-ACETYL-B-D-GLUCOSAMINIDE 2123
48712-1GM O-NITROPHENYL-B-D-GALACTOPYRANOSIDE 535
48712-5GM O-NITROPHENYL-B-D-GALACTOPYRANOSIDE 2056
487500-1GM P-NITROPHENYL-B-D-GLUCURONIDE 2240
487506-1GM P-NITROPHENYL-A-D-GLUCOPYRANOSIDE 585
487506-5GM P-NITROPHENYL-A-D-GLUCOPYRANOSIDE 1939
487507-1GM P-NITROPHENYL-B-D-GLUCOPYRANOSIDE 870
487526-10MG P-NITROPHENYL-A-D-MALTOPENTAOSIDE 819
487528-10MG P-NITROPHENYL-A-D-MALTOTETRAOSIDE 569
487542-50MG P-NITROPHENYL-A-D-MALTOSIDE 870
487600-1EA P-NITROPHENYL PHOSPHATE, 2NA, TABLETS 1939
4876-1GM P-NITROPHENYL PHOSPHATE, DISODIUM SALT 535
487655-100GM P-NITROPHENYL PHOSPHATE, DITRIS SALT 3845
487655-5GM P-NITROPHENYL PHOSPHATE, DITRIS SALT 619
4876-5GM P-NITROPHENYL PHOSPHATE, DISODIUM SALT 2056
487663-10ML P-NITROPHENYL PHOSPHATE 1739
487664-500ML P-NPP SUBSTRATE BUFFER 1889
487666-1EA P-NITROPHENYL PHOSPHATE TABLETS 1187
487870-1GM P-NITROPHENYL-BETA-D-XYLOPYRANOSIDE 2240
487910-1SET (+/-)-S-NITROSO-N-ACETYLPENICILLAMINE 3042
487910-20MG (+/-)-S-NITROSO-N-ACETYLPENICILLAMINE 1287
487912-1SET ANTI-SNAP-25 RABBIT PAB 4900
487920-10MG S-NITROSOGLUTATHIONE 853
487920-1SET S-NITROSOGLUTATHIONE 2624
487920-50MG S-NITROSOGLUTATHIONE 3343
487923-50UG ANTI-NITROTYROSINE MO MAB (CC22.8C7.3) 2384
487924-150UG ANTI-NITROTYROSINE RABBIT PAB 4973
487925-5MG NBQX 2457
487927-10MG NOC-9 803
487928-10MG NOCODAZOLE 1087
487950-10MG NOC-5 2123
487952-10MG NOC-7 2123
487955-10MG NOC-12 2357
487957-10MG NOC-18 2357
487960-1MG NOCICEPTIN 1939
488230-1MG NOGO-66 (1-40) ANTAGONIST PEPTIDE, SYNTH 4563
488250-1KTT NON-INTERFERING PROTEIN ASSAY KIT 4127
488285-1GM N-NONYL-B-D-GLUCOPYRANOSIDE 2274
489350-100MG L-(-)-NOREPINEPHRINE-(+)-BITARTRATE 619
489475-50UG ANTI-LRP-5/6 (421-431), HUMAN (MOUSE) 3671
489530-10MG NOR-3 2858
489530-1SET NOR-3 5335
490070-1MG NNOS INHIBITOR I 2294
490070-5MG NNOS INHIBITOR I 5224
491001-1MG NOTCH 1 MUTATED PEPTIDE, FLUOROGENIC 1789
491002-1MG Notch Transcription Factor Inhibitor SAHM1 2486
491010-50UL ANTI-NOTCH 1 HAMSTER MAB 2896
491011-50UG ANTI-NOTCH 1, CYTOPLASMIC DOMAIN RB PAB 2896
491207-10GM NOVOBIOCIN, SODIUM SALT 2875
491207-1GM NOVOBIOCIN, SODIUM SALT 519
492016-1000ML NP-40 ALTERNATIVE 3661
492016-100ML NP-40 ALTERNATIVE 619
492016-500ML NP-40 ALTERNATIVE 1889
492018-500ML NP-40 ALTERNATIVE, PROTEIN GR. 10% SOLN 3928
492018-50ML NP-40 ALTERNATIVE, PROTEIN GR. 10% SOLN 1020
492030-5MG NS 2028 2792
492035-5MG NSC 721648 2469
492899-15KU NUCLEASE, STAPHYLOCOCCUS AUREUS 2622
493800-5MG PARP INHIBITOR VI, NU1025 2457
494126-100UG GHRELIN, HUMAN, SYNTHETIC 3297
494127-100UG GHRELIN, RAT, MOUSE, SYNTHETIC 2469
494459-1GM N-OCTYL-B-D-GLUCOPYRANOSIDE 1137
494459-25GM N-OCTYL-B-D-GLUCOPYRANOSIDE 13288
494459-5GM N-OCTYL-B-D-GLUCOPYRANOSIDE 3995
494460-1GM N-OCTYL-B-D-GLUCOPYRANOSIDE, ULTROL 3326
494460-250MG N-OCTYL-B-D-GLUCOPYRANOSIDE, ULTROL 853
494460-5GM N-OCTYL-B-D-GLUCOPYRANOSIDE, ULTROL 11065
494461-5GM N-OCTYL-B-D-THIOGLUCOPYRANOSIDE, ULTROL 4079
494465-1GM OCTYL-B-D-MALTOPYRANOSIDE 3076
494466-5GM N-OCTANOYLSUCROSE 2959
495320-10MG ODQ 2357
495414-1SET 1-OLEOYL-2-ACETYL-SN-GLYCEROL 2274
495414-25MG 1-OLEOYL-2-ACETYL-SN-GLYCEROL 3326
495414-5MG 1-OLEOYL-2-ACETYL-SN-GLYCEROL 1003
495417-25MG N-OLEOYL ETHANOLAMINE 2842
4954-1GM OLEIC ACID 502
495455-10MG OLIGOMYCIN 1237
495604-100UG OKADAIC ACID, PROROCENTRUM SP. 4079
495604-25UG OKADAIC ACID, PROROCENTRUM SP. 1254
495609-25UG INSOLUTION OKADAIC ACID, P. CONCAVUM 1413
495620-1MG OLOMOUCINE 619
495620-5MG OLOMOUCINE 2591
495621-5MG OLOMOUCINE II 2825
495622-1MG OLOMOUCINE, ISO- 753
495622-5MG OLOMOUCINE, ISO- 3326
495624-5MG INSOLUTION(TM) OLOMOUCINE 3769
496000-250UG INSOLUTION(TM) OM99-2 6118
496100-50MG OMEPRAZOLE 1672
496150-10MG OMI/HTRA2 PROTEASE INHIBITOR, UCF-101 1822
496260-10UG ONCOSTATIN M, HU., RECOM 5365
496265-25MG ONCRASIN-1 1185
496915-5MG ORIDONIN, R. RUBESCENS 1521
497985-10MG ORNITHINE DECARBOXYLASE INHIBITOR, POB 1475
499050-100UG OSTEOCALCIN, BOVINE BONE 4346
499055-100UL ANTI-OSTEOCALCIN (1-22) RABBIT PAB 4315
499240-50UG OSTEONECTIN, BOVINE BONE 4897
499250-50UG OSTEONECTIN, HUMAN PLAETS 6636
499255-100UL ANTI-OSTEONECTIN RABBIT PAB 4315
499260-50UG OSTEOPONTIN, HISTAG, MO, REC, MO 5416
499265-100UL ANTI-OSTEOPONTIN (75-90) RABBIT PAB 4168
4995-1GM OUABAIN, OCTAHYDRATE 1313
499609-1MG (5Z)-ZEAENOL, CURVULARIA SP. 1640
499610-1MG (5Z)-7-OXOZEAENOL, CURVULARIA SP. 2386
499643-500MG MUCIN, BOVINE SUBMAXILLARY GLAND 3124
499700-1MG OXAMFLATIN 1605
499700-5MG OXAMFLATIN 5533
5000-5GM OXALACETIC ACID 753
500095-1KIT OXYDNA ASSAY KIT, FLUOROMETRIC 10246
500105-100GM OXYTETRACYCLINE, HYDROCHLORIDE 1989
500105-10GM OXYTETRACYCLINE, HYDROCHLORIDE 351
506101-2MG P21-ACTIVATED KINASE INHIBITOR, PAK18 4145
506102-2MG P21-ACTIVATED KINASE INHIBITOR, NEG CTRL 4012
506104-50UG P21 WAF1, GST-FUSION PROTEIN, HU, REC. 4028
506106-25MG P21-ACTIVATED KINASE INHIBITOR III,IPA-3 4788
506106-5MG P21-ACTIVATED KINASE INHIBITOR III,IPA-3 1658
506107-1SET ANTI-P2X7 RECEPTOR RABBIT PAB 2925
506114-200U P34CDK1/CYCLIN B, HU. RECOM 4329
506119-10T ANTI-P38 MAPK (PTHR180,TYR182) RB PAB 5104
506120-200U P34CDK1/CYCLIN B1, XENOPUS, RECOMB. 4647
506121-1MG P38 MAP KINASE INHIBITOR III 2257
506123-200UL ANTI-P38 MAP KINASE RABBIT PAB 4724
506124-5UG P38BETA,GST-FUSION,MO.,REC.,S.FRUGIPERDA 3377
506126-500UG P38 MAP KINASE INHIBITOR 1822
506128-50UL PD ANTI-P27KIP-1 (PTHR187) RABBIT PAB 4900
506131-500UG P53 ACTIVATOR, CELL-PERMEABLE 4112
506132-10MG PIFITHRIN-A 2073
506132-5MG PIFITHRIN-A 1221
506133-100UG PD ANTI-P53 (PSER392) MOUSE MAB (9F4) 4900
506134-10MG PIFITHRIN-A, CYCLIC- 2357
506136-500UG P53, MDM-2 BINDING DOMAIN, N-TERMINAL 3761
506146-5000U P53 (1-342, C-TERMINAL DELETION), RECOM 8675
506147-5000U P53, WILD-TYPE, HISTAG, HU., RECOM 10262
506148-1MG INSOLUTION P38 MAPK INHIBITOR III 2257
506149-1MG P53 ACTIVATOR III, RITA 1455
506151-50UG IRSP53, HIS*TAG FUSION 2407
506152-5MG PIFITHRIN-ALPHA, <I>P</I>-NITRO 1572
506153-10MG P38 MAP KINASE INHIBITOR IV 2137
506154-5MG PIFITHRIN-ALPHA, <I>P</I>-NITRO, CYCLIC 1772
506155-10MG PIFITHRIN-MU 1605
506156-1MG P38 MAP KINASE INHIBITOR V 2775
506157-5MG P38 MAP KINASE INHIBITOR VI, JX401 2591
506158-10MG P38 MAP KINASE INHIBITOR VII, SD-169 2090
506161-2MG P38 MAP KINASE INHIBITOR IX 7439
506163-5MG P38 MAP KINASE INHIBITOR VIII 1454
506164-5MG MUTANT P53 REACTIVATOR, RETRA 2636
506165-10UG P53, HISTAG, HUMAN, RECOMBINANT, E. COLI 6278
506166-5MG P53 MODULATOR, CP-31398 1325
506168-25MG p53 Activator VII, STIMA-1  889
506179-5UG P70S6K, HIS*TAG, HU, REC, S. FRUGIPERDA 4028
506181-500UG P75NTR SIGNALING INHIBITOR, TAT-PEP5 2925
506200-1SET P300, RECOMBINANT 7841
506274-5MG PACOCF3 1216
506280-10UG PA28 ACTIVATOR, RABBIT 4229
506345-100GM PALMITIC ACID 3761
506345-25GM PALMITIC ACID 1455
506350-2MG PAM3CYS-SER-LYS4, HCL 3611
506600-10MG PAMIDRONATE DISODIUM 1455
507313-1ML ANTI-ALBUMIN GOAT PAB 863
507858-10GM PANSORBIN CELLS 5984
507858-1GM PANSORBIN CELLS 1037
507858-25GM PANSORBIN CELLS 13655
507858-50GM PANSORBIN CELLS 22196
507858-5GM PANSORBIN CELLS 4162
507861-25ML PANSORBIN CELLS, STANDARDIZED 2090
507861-50ML PANSORBIN CELLS, STANDARDIZED 3794
507862-1GM PANSORBIN CELLS, LYOPHILIZED 1104
507862-5GM PANSORBIN CELLS, LYOPHILIZED 4413
511071-2MG PAF RECEPTOR ANTAGONIST, ABT-491 1839
511075-1MG PLAET ACTIVATING FACTOR-16 535
511075-5MG PLAET ACTIVATING FACTOR-16 1421
5125-50GM PAPAIN, CARICA PAPAYA 1187
512585-100UG PARATHYROID HORMONE 1-34, RAT 1739
512729-1KIT PARP CLEAVAGE DETECTION KIT 5996
512731-5GM PAROMOMYCIN SULFATE 1388
512732-50MG PARTHENOLIDE, TANACETUM PARTHENIUM 1137
512734-100UL ANTI-PARP-1 RABBIT PAB 4534
512737-100UL ANTI-PARP-1 AUTOMOD DOM (509-524) RB PAB 4534
512738-100UL ANTI-PARP-1 (197-214) RABBIT PAB 4315
512739-100UL ANTI-PARP (215-228) RABBIT PAB 4607
512743-50UG PASTEURELLA MULTOCIDA TOXIN 7417
512777-10UG PBSF/SDF-1B, HUMAN, RECOMB. 5767
513000-10MG PD 98059 1984
513000-25MG PD 98059 2649
513000-5MG PD 98059 1551
513001-1ML INSOLUTION(TM) PD 98059 1772
513020-500UG PD 145065 1889
513021-1MG PD 145305 1839
513022-5MG PD 150606 1806
513024-5MG PD 151746 3315
513028-5MG PD 166285 1604
513030-1MG PD 169316 1889
513033-1MG PD 168393 2006
513035-500UG PD 158780 1989
513036-500UG INSOLUTION PD 158780 1989
513040-1MG PD 174265 1739
513100-50MG DL-THREO-PDMP, HCL 3769
516045-200UL ANTI-PER1 (39-51) RABBIT PAB 5145
516090-100MG PENCICLOVIR 1989
516104-20ML PEN/STREPT/AMPHO B SOLN. (100X) TC GR. 652
516106-20ML PENICILLIN/STREPTOMYCIN, 100X, TC GRADE 569
5161-100MU PENICILLIN G, POTASSIUM SALT 1455
5161-25MU PENICILLIN G, POTASSIUM SALT 552
516354-500MG PENTOXIFYLLINE 519
516360-2.5GM PEPSIN, PORCINE STOMACH MUCOSA 2718
516360-500MG PEPSIN, PORCINE STOMACH MUCOSA 669
516481-100MG PEPSTATIN A, SYNTHETIC 6418
516481-25MG PEPSTATIN A, SYNTHETIC 2190
516481-5MG PEPSTATIN A, SYNTHETIC 736
516483-1MG PEPSTATIN A, PENETRATIN 3092
516485-1MG PEPSTATIN A METHYL ESTER 1254
516515-100UG ANTI-PERFORIN MOUSE MAB (DG9) 4666
516516-120T ANTI-PERFORIN MOUSE MAB (DG9) FITC CONJ. 4929
516531-25KU PEROXIDASE, HORSERADISH 4045
516531-5KU PEROXIDASE, HORSERADISH 1003
516557-100UL ANTI-PGC-1, C-TERM (777-797) RABBIT PAB 4900
516559-10KU PPARA, HUMAN, RECOMBINANT, E. COLI 6552
516560-50UG PERTUSSIS TOXIN, BORDELA PERTUSSIS 4179
516561-50UG PERTUSSIS TOXIN IN GLYCEROL 4179
516562-50UG PERTUSSIS TOXIN, SALT-FREE 4179
516565-10MG PEROXISOME PROLIFERATOR, CETABEN 1889
516566-50MG PPARGAMMA ANTAGONIST III, G3335 1488
516620-1SET PEROXYNITRITE 1956
516640-1MG PHALLOIDIN, AMANITA PHALLOIDES 2875
516641-200UG PHALLOIDIN OLEATE 2507
516676-100UG ANTI-4EBP1/PHAS-I (101-118) RABBIT PAB 4183
516678-50UG 4EBP1, HIS*TAG, HU, REC, S. FRUGIPERDA 4028
516705-500MG O-PHENANTHROLINE 936
516724-100GM PHENOL, MB GRADE 1362
516724-500GM PHENOL, MB GRADE 2140
516726-1SET PHENOL/CHLOROFORM/ISOAMYL ALCOHOL 2390
516735-50MG PHENOLPHTHALEIN GLUCURONIDE, SODIUM SALT 1087
516798-25GM PHENYLPHOSPHATE, DISODIUM SALT 853
516852-40UG PERTUSSIS TOXIN, A PROTOMER, B PERTUSSIS 8291
516854-10UG PERTUSSIS TOXIN, A PROTOMER, B PERTUSSIS 8375
516900-50ML PEROXIDASE, HORSERADISH CONJUGATE STABIL 619
517301-10MG P-GLYCOPROTEIN INHIBITOR, C-4 2591
517308-500UL ANTI-P-GLYCOPROTEIN MOUSE MAB (4E3.16) 4768
517310-500UL ANTI-P-GLYCOPROTEIN MOUSE MAB (C219) 6349
517312-500UL ANTI-P-GLYCOPROTEIN MOUSE MAB (C494) 4768
5202-100GM L-PHENYLALANINE 1087
520219-10MG PPACK II, TFA SALT 3238
520222-25MG PPACK, DIHCL 9859
520222-5MG PPACK, DIHCL 3000
520224-1MG PPACK, BIOTINYLATED 7070
521000-250MG PHENYLARSINE OXIDE 619
521200-1UG PDGF, HUMAN PLAETS 5716
521215-10UG PDGF, AA-CHAIN HOMODIMER, HU., R 5833
521220-10UG PDGF, AB HETERODIMER, HUMAN, RECOM 6552
521225-10UG PDGF, BB HOMODIMER, HU., RECOM 6669
521231-1MG PDGFR TYROSINE KINASE INHIBITOR II 2909
521232-1MG PDGFR TYROSINE KINASE INHIBITOR III 1956
521233-1MG PDGFR TYROSINE KINASE INHIBITOR IV 2507
521234-1MG PDGF RECEPTOR TYROSINE KINASE INHIBITOR 2959
521235-5MG PDGFR TYROSINE KINASE INHIBITORVI,SU6668 3131
521236-5MG PDGFR/VEGFR2TYROSINEKINASEINHIBITOR,5-BR 2634
521237-5MG PDGFR TYROSINE KINASE INHIBITOR VII 2359
521270-5UG PDK1, HIS-TAG, RECOMBINANT 7137
521275-5MG PDK1/AKT/FLT DUAL PATHWAY INHIBITOR *KP- 4179
521726-100UG PLAET FACTOR 4, HUMAN PLAETS 4279
523120-1EA O-PHENYLENEDIAMINE, DIHCL, 2-MG TABLETS 1605
523121-1EA O-PHENYLENEDIAMINE, DIHCL, 10-MG TABLETS 1856
523310-10MG PTEROSTILBENE, PTEROCARPUS MARSUPIUM 2741
52332-1GM PHENYLMETHYLSULFONYL FLUORIDE 519
52332-25GM PHENYLMETHYLSULFONYL FLUORIDE 2892
52332-5GM PHENYLMETHYLSULFONYL FLUORIDE 970
523350-25MG PTIO 1989
524371-10GM PHM-L LIPOSORB ABSORBENT 5629
524371-1GM PHM-L LIPOSORB ABSORBENT 914
524382-5MG 4A-PHORBOL 2274
524390-1MG PHORBOL-12,13-DIBUTYRATE 936
524390-5MG PHORBOL-12,13-DIBUTYRATE 2725
524394-1MG 4A-PHORBOL-12,13-DIDECANOATE 1488
524394-5MG 4A-PHORBOL-12,13-DIDECANOATE 4747
524400-10MG PHORBOL-12-MYRISTATE-13-ACETATE 4313
524400-1MG PHORBOL-12-MYRISTATE-13-ACETATE 761
524400-25MG PHORBOL-12-MYRISTATE-13-ACETATE 8023
524400-5MG PHORBOL-12-MYRISTATE-13-ACETATE 1975
524403-25MG PRAVASTATIN, SODIUM SALT 1338
524488-200MG PHLORETIN 1505
524529-1KU PHOSPHATASE, ACID, POTATO 4079
524545-100U PHOSPHATASE, ALKALINE, E. COLI 7806
524572-1KU PHOSPHATASE, ALKALINE, CALF INTESTINE 619
524572-5KU PHOSPHATASE, ALKALINE, CALF INTESTINE 2357
524576-1000U PHOSPHATASE, ALKALINE, CALF INTESTINE 2106
524583-50UL ANTI-PHOSPHODIESTERASE V RABBIT PAB 4841
524604-100U PHOSPHATASE, ALKALINE, HUMAN PLACENTA 3009
524611-5MG PIKFYVE INHIBITOR 3297
524612-100UG PI-3-P, DIPALMITOYL-, TRIAMMONIUM SALT 2390
524613-100UG PI-3,4-P2, DIPALMITOYL-, PENTAAMMONIUM 3159
524614-100UG PI-4,5-P2, DIPALMITOYL-, PENTAAMONIUM 2357
524615-100UG PI-3,4,5-P3, DIPALMITOYL-, HEPTAAMMO 3677
524616-250UG PI-3,5-P2, DIPALMITOYL- 2792
524617-250MG L-A-LECITHIN, EGG YOLK, HIGHLY PURIFIED 870
524624-1SET PHOSPHATASE IN. COCKTAIL I 3276
524625-1SET PHOSPHATASE INHIBITOR COCKTAIL SET II 4112
524627-1ML PHOSPHATASE INHIBITOR COCKTAIL SET III 2223
524627-1SET PHOSPHATASE INHIBITOR COCKTAIL SET III 7605
524628-1ML PHOSPHATASE INHIBITOR COCKTAIL SET IV 1455
524628-1SET PHOSPHATASE INHIBITOR COCKTAIL SET IV 5466
524629-1ML PHOSPHATASE INHIBITOR COCKTAIL SET V,50X 2240
524629-1SET PHOSPHATASE INHIBITOR COCKTAIL SET V,50X 7505
524631-1ML Phosphatase Inhibitor Cocktail Set III, Lyophilized  1328
524632-1ML PHOSPHATASEINHIBITORCOCKTAILSETV,50XLYOP 2617
524632-1SET PHOSPHATASEINHIBITORCOCKTAILSETV,50XLYOP 8766
524644-100UG L-A-PHOSPHATIDYL-D-MYO-INO-4,5-BISPHOSPH 1137
524644-1MG L-A-PHOSPHATIDYL-D-MYO-INO-4,5-BISPHOSPH 5633
524647-1MG L-A-PHOSPHATIDYL-D-MYO-INOSITOL-4-PO4 3581
524650-1EA PBS TABLETS 635
524653-1EA PBS-TWEEN TABLETS 723
524711-10U PDE, TYPE II, CALF SPLEEN 3761
524715-50UL PHOSPHODIESTERASE, TYPE V, CGMP-SPECIFIC 4246
524718-1SET PHOSPHODIESTERASE INHIBITOR SET I 6620
524731-10U PHOSPHODIESTERASE 4A4, HISTAG, HUMAN, RE 4463
524732-10U PHOSPHODIESTERASE 4B2, CATALYTIC DOMAIN, 4463
524733-10U PHOSPHODIESTERASE 4D3, HISTAG, HUMAN, RE 4463
524734-10U PHOSPHODIESTERASE 3B, HISTAG, HUMAN, REC 4463
524735-10U PHOSPHODIESTERASE 11A1, HU., RECOM 4463
524736-10U PHOSPHODIESTERASE 4B2, HISTAG, HUMAN, RE 4463
524737-10U PHOSPHODIESTERASE 4C2, HISTAG, HUMAN, RE 4463
524738-10U PHOSPHODIESTERASE 5, HU., RECOM 4463
524739-10U PHOSPHODIESTERASE 10A2, HISTAG, HUMAN, R 3895
524740-10U PHOSPHODIESTERASE 1A3, HISTAG, HUMAN, RE 4463
524742-10U PHOSPHODIESTERASE 3A, ACTIVE, HUMAN, REC 4456
524743-100UG SIRT1, GST-FUSION PROTEIN, HU, REC 6602
524744-100UG SIRT2,  HIS*TAG, HUMAN, REC., E. COLI 6602
524745-100UG SIRT3, GST-FUSION PROTEIN, HU, REC. 6602
524746-10U PHOSPHODIESTERASE4D5,ACTIVE,HUMAN,RECOMB 4456
524747-10U PHOSPHODIESTERASE8A1,ACTIVE,HUMAN,RECOMB 4456
524749-10U PHOSPHODIESTERASE 6AB, ACTIVE, HUMAN, RE 7272
524750-1EA TBS TABLETS 812
524751-10U PHOSPHODIESTERASE 7A1, HUMAN, RECOMBINAN 4456
524753-1EA TBST TABLETS 1250
524810-100U PHOSPHOENOLPYRUVATE CARBOXYLASE, Z. MAYS 1588
525143-500UG CPLA2A INHIBITOR 3326
525145-1MG SPLA2-IIA INHIBITOR I 1906
525154-50UG ANTI-PHOSPHOLAMBAN MOUSE MAB (A1) 4958
525185-10MG PHOSPHOLIPASE C ACTIVATOR, M-3M3FBS 1304
525186-250U PHOSPHOLIPASE C, BACILLUS CEREUS 4430
525188-50UG PHOSPHOLIPASE C-GAMMA-1, HIS*TAG FUSION 2875
525189-50UG PHOSPHOLIPASE C-GAMMA-2, HIS*TAG FUSION 2875
525200-250U PHOSPHOLIPASE D, S. CHROMOFUSCUS 3209
525276-5MG PHOSPHORAMIDON, DISODIUM SALT 2691
525278-1KIT PHOSPHOPROTEIN ENRICHMENT KIT 9084
525280-1SET PD ANTI-SERINE MOUSE MAB (16B4) 4797
525281-1SET PD ANTI-SERINE (1C8) MOUSE MAB (1C8) 5265
525282-1KIT PHOSPHODETECT (TM) SERINE DETECTION KIT 7734
525283-1SET PD ANTI-SERINE (4A3) MOUSE MAB (4A3) 5192
525284-1SET PD ANTI-SERINE (4A9) MOUSE MAB (4A9) 5265
525286-1SET PD ANTI-THREONINE MOUSE MAB (14B3) 4797
525287-1SET PD ANTI-THREONINE MOUSE MAB (1E11) 5192
525288-1KIT PHOSPHODETECT THREONINE DETECTION KIT 6759
525290-100UG PD ANTI-TYROSINE RABBIT PAB 4695
525295-100UG PD ANTI-TYROSINE MOUSE MAB (PY20) 4724
525300-500UL PD ANTI-TYR MO MAB (PY20) AGAR CONJ. 5806
525305-100UG PD ANTI-TYROSINE MO MAB (PY20) APC 4739
525310-100UG PD ANTI-TYR MO MAB (PY20) BIO CONJ. 4739
525320-100UG PD ANTI-TYR MO MAB (PY20) PEROX CONJ 4797
525322-1KIT PD TYROSINE DETECTION KIT 7913
525324-1ST PHOSPHOTYROSINE MOLECULAR WEIGHT MARKERS 3554
525325-1SET PHOSPHOTYROSINE PHOSPHATASE INHIB SET (V 3778
525326-200UL PD ANTI-TYROSINE MOUSE MAB (P3-54) 3130
526511-250MG PHYTOHEMAGGLUTININ-M, PHASEOLUS VULGARIS 2658
526520-5MG PIM1 KINASE INHIBITOR II 1605
526521-1MG PIM-1 INHIBITOR III 3226
526522-5MG PIM1 KINASE INHIBITOR IV 1475
526523-5MG PIM1/2 KINASE INHIBITOR V 1309
526524-5MG PIM1/2 KINASE INHIBITOR VI 1309
526552-20UG PI 3-KALPHA,P110ALPHA/P85ALPHA,HU,REC,SF 6444
526553-100UL ANTI-PI-3-K P110D (1026-1044) RB PAB 4826
526554-5UG PI 3-KBETA,P110BETA/P85ALPHA,HU,REC. 4028
526555-50UG PI3K NT-FRAG., HIS*TAG FUSION 2407
526556-5UG PI3-KGAMMA,HIS*TAG,HU.,REC.,S.FRUGIPERDA 4028
526558-5UG PI 3-KDELTA,P110DELTA/P85ALPHA,HU,REC 3761
526610-5UG PIGF-1, HU., RECOM 4045
527450-5MG PKR INHIBITOR 1822
527455-10MG PKR INHIBITOR, NEGATIVE CONTROL 1772
527460-10T PD ANTI-PKR (PTHR451) RABBIT PAB 5104
527621-10U PLASMIN, HUMAN PLASMA 3510
527622-1MG PLASMIN, HUMAN, RECOMBINANT 8696
527624-10U PLASMIN, EACA- AND LYSINE-FREE, PLASMA 4196
527948-1MG PICEATANNOL 803
527962-100MG PIMARICIN, STREPTOMYCES CHATTANOOGENSIS 2725
527962-1GM PIMARICIN, STREPTOMYCES CHATTANOOGENSIS 15594
528100-1MG PI-103 1822
528100-5MG PI-103 6619
528101-2MG INSOLUTION PI-103 3131
528105-100MG PICROTOXIN, ANAMIRTA COCCULIN 520
528106-5MG PI 3-K GAMMA INHIBITOR ''AS-605240'' 2691
528107-100UG ANTI-PI-3-KINASE MOUSE MAB (AB6) 4900
528108-5MG PI 3-KGAMMA INHIBITOR II ''AS-604850'' 2507
528110-50MG PIH 2056
528111-5MG PI 3-KALPHA INHIBITOR IV 3326
528112-5MG PI 3-KG/CKII INHIBITOR *AS-252424* 2507
528113-1MG PI 3-KBETA INHIBITOR VI, TGX-221 4379
528114-5MG PI 3-KGAMMA INHIBITOR VII 2173
528116-5MG PI 3-KALPHA INHIBITOR VIII 3310
528117-5MG PI 3-K INHIBITOR IX, PIK-90 4095
528119-5MG PI 3-K Inhibitor XI, HWT 1887
528120-10MG PIPER 1572
528131-100GM PIPES, FREE ACID, ULTROL GRADE 1438
528132-100GM PIPES, SESQUISODIUM SALT, ULTROL GRADE 1438
528132-1KG PIPES, SESQUISODIUM SALT, ULTROL GRADE 9260
528150-1MG PARP INHIBITOR VIII, PJ34 1020
528150-5MG PARP INHIBITOR VIII, PJ34 3143
528156-5UG PKD2, GST-FUSION PROTEIN, HU., RECOM 6151
528175-120U PLASMINOGEN, HUMAN PLASMA 4045
528178-50U PLASMINOGEN, EACA-& LYS-FREE, HU. PLASMA 4196
528180-1MG PLASMINOGEN, GLU-TYPE, HUMAN PLASMA 3895
528185-1MG PLASMINOGEN, LYS-TYPE, HUMAN PLASMA 4797
528198-25MG PLASMINOGEN ACTIVATOR SUBSTRATE 1271
528205-50UG PLASMINOGEN ACTIVATOR INHIBITOR-1, RECOM 3845
528208-50UG PLASMINOGEN ACTIVATOR INHIBITOR-1, RECOM 3761
528213-50UG PLASMINOGEN ACTIVATOR INHIBITOR-1, RECOM 3627
528214-50UG PAI-1, RAT, RECOM 3627
528215-100UG ANTI-PAI-1 (MA-33B8) MOUSE MAB (MA-33B8) 3657
528216-100UG ANTI-PAI-1 RABBIT PAB 4051
528217-100UG ANTI-PAI-1 MOUSE MAB (MA-33H1F7) 3657
528240-1MG PLAET MEMBRANE GLYCOPROTEINS, IIBIIIA 6719
528244-250UG PLATENSIMYCIN, STREPTOMYCES SP. 4125
528281-10MG Polo-like Kinase Inhibitor IV, SBE13  989
528282-5MG POLO-LIKE KINASE INHIBITOR I 2507
528283-2MG POLO-LIKE KINASE INHIBITOR II, BTO-1 1301
528284-500UG POLO-LIKE KINASE INHIBITOR III 1309
528285-1MG PLKTIDE 2469
528315-100GM PIPPS 3343
528815-100UL ANTI-PAR RABBIT PAB 4768
528819-5MG PARP INHIBITOR XI, DR2313 2140
528820-1SET PARP INHIBITOR SET 5449
528822-5MG PARP INHIBITOR XII 3126
528824-10MG PARP INHIBITOR XIV 2965
528875-25GM PEG 1000 736
528877-100GM PEG 6000, MB GRADE 351
528877-1KG PEG 6000, MB GRADE 1789
528906-10MG POLYINOSINIC ACID.POLYCYTIDYLIC ACID 1053
5291-1GM POLYMYXIN B SULFATE 970
5291-500MG POLYMYXIN B SULFATE 585
5291-5GM POLYMYXIN B SULFATE 4313
529313-1MG POLYOXIN D, STREPTOMYCES CACAOI VAR. ASO 2491
5295-100GM POLYVINYLPYRROLIDONE 619
529532-100UG ANTI-PORIN 31HL MO MAB (89-173/016) 3598
529543-1KG POTASSIUM ACETATE, MB GRADE 1572
529543-250GM POTASSIUM ACETATE, MB GRADE 502
529544-100ML POTASSIUM ACETATE,5 M,MBG,DEPC-TREATED 753
529552-1KG POTASSIUM CHLORIDE, MB GRADE 903
529552-250GM POTASSIUM CHLORIDE, MB GRADE 351
529567-1KG K PHOSPHATE, DIBASIC, 3H2O, MB GRADE 1989
529567-250GM K PHOSPHATE, DIBASIC, 3H2O, MB GRADE 769
529568-1KG POTASSIUM PHOSPHATE, MONOBASIC, MB GRADE 1488
529568-250GM POTASSIUM PHOSPHATE, MONOBASIC, MB GRADE 602
529570-10MG PPM-18 1822
529573-1MG PP2 1772
529573-5MG PP2 2649
529574-1MG PP3 1087
529576-1MG INSOLUTION(TM) PP2 2030
529577-1MG PREALBUMIN, HUMAN PLASMA 2758
529578-10MG PPM1D PHOSPHATASE INHIBITOR 1640
529579-1MG PP1 ANALOG 1789
529581-1MG PP1 ANALOG II, 1NM-PP1 1572
529583-1MG PREKALLIKREIN, HUMAN PLASMA 9393
529584-5MG PTK/PI 3-K/MTOR INHIBITOR, PP121 1520
529589-1MG PRESENILIN 1, CT-15 PEPTIDE, CELL-PERM. 3761
529591-100UL ANTI-PRESENILIN 1, N-TERM (1-65) RB PAB 4870
529592-100UL ANTI-PRESENILIN 1, (263-407) RB PAB 4870
529594-100UL ANTI-PRESENILIN 2, (269-394) RB PAB 4783
529600-100ML PRIONEX REAGENT 3661
529625-1MG POLYPHOSPHOINOSITIDE-BINDING PEPTIDE 3995
529627-10MG PPIASE-PARVULIN INHIBITOR 1555
529660-5UG PROCASPASE-3, HISTAG, HUMAN, REC,E. COLI 6636
529661-10MG PROCASPASE-3 ACTIVATOR, PAC-1 2407
530006-100UG PRION PROTEIN, HISTAG, HU., RECOM 7037
530050-10MG PRIMA-1 1789
530070-5MG PRISTIMERIN 1855
530311-100UG ANTI-AKT1 (88-100) RABBIT PAB 5661
5341-25GM PROGESTERONE 1087
534736-10U PDE3A1, CATALYTIC DOMAIN, HU., RECOM 4463
535140-1ML PROTEASE INHIBITOR COCKTAIL SET III 1087
535140-1SET PROTEASE INHIBITOR COCKTAIL SET III 4877
535141-1ML PROTEASE INHIBITOR COCKTAIL V, ANI-FREE 1053
535141-1SET PROTEASE INHIBITOR COCKTAIL V, ANI-FREE 3778
535142-1ML PROTEASE INHIBITOR COCKTAIL I, ANI-FREE 519
535142-1SET PROTEASE INHIBITOR COCKTAIL I, ANI-FREE 3761
535851-5UG SGK1, GST-FUSION PROTEIN, HU., RECOM 1939
535857-20UG PTP-MEG2, GST-FUSION PROTEIN, RECOM 3243
5370-100GM L-PROLINE 1003
537011-5MG PROLYL ENDOPEPTIDASE INHIBITOR II 2788
53702-10KU PRONASE PROTEASE, STREPTOMYCES GRISEUS 619
53702-250KU PRONASE PROTEASE, STREPTOMYCES GRISEUS 6636
53702-25KU PRONASE PROTEASE, STREPTOMYCES GRISEUS 970
53702-500KU PRONASE PROTEASE, STREPTOMYCES GRISEUS 11483
53702-50KU PRONASE PROTEASE, STREPTOMYCES GRISEUS 1856
537059-100MG PROPIDIUM IODIDE 2324
537059-1GM PROPIDIUM IODIDE 18569
537059-250MG PROPIDIUM IODIDE 5482
537059-50MG PROPIDIUM IODIDE 1271
537060-5ML PROPIDIUM IODIDE SOLUTION 1087
537075-100MG (+/-)-PROPRANOLOL, HCL 569
537088-100KU PRONASE PROTEASE, S. GRISEUS, NUCLEASE-F 8079
537088-10KU PRONASE PROTEASE, S. GRISEUS, NUCLEASE-F 1287
537088-25KU PRONASE PROTEASE, S. GRISEUS, NUCLEASE-F 2708
537088-50KU PRONASE PROTEASE, S. GRISEUS, NUCLEASE-F 5073
537088-5KU PRONASE PROTEASE, S. GRISEUS, NUCLEASE-F 853
538540-100UG MMP-7, PROENZYME, HUMAN, RECOMB. E. COLI 4831
538903-1MG PROSTAGLANDIN E1 1287
538904-1MG PROSTAGLANDIN E2 1287
538907-1MG PROSTAGLANDIN F2A 1287
538909-1MG PROSTAGLANDIN D2 1806
538916-1MG 16,16-DIMETHYL PROSTAGLANDIN E2 1256
538925-1MG PROSTAGLANDIN I2, SODIUM SALT 4079
538927-1MG 15D-PGJ2 1856
538944-1MG U-46619 2842
539053-5T PROTEIN MOLECULAR WEIGHT MARKERS, HPLC 2618
539109-1MG PAR-2 AGONIST I 1521
539109-5MG PAR-2 AGONIST I 4346
539111-5MG PAR-2 AGONIST III 1604
539122-5GM PROTAMINE SULFATE, SALMON MILT 870
539124-1SET PROTEASE ARREST REAGENT 2957
539125-1KIT PROTEASE ASSAY KIT 7466
539128-1SET PROTEASE INHIBITOR SET 4998
539129-1ML PROTEASE INHIBITOR COCKTAIL SET VIII 1187
539129-1SET PROTEASE INHIBITOR COCKTAIL SET VIII 4998
539131-10VL PROTEASE INHIBITOR COCKTAIL SET I 3535
539131-1VL PROTEASE INHIBITOR COCKTAIL SET I 462
539132-1SET PROTEASE INHIBITOR COCKTAIL SET II 1455
539132-5SET PROTEASE INHIBITOR COCKTAIL SET II 5700
539133-1ML PROTEASE INHIBITOR COCKTAIL SET VI 1137
539133-1SET PROTEASE INHIBITOR COCKTAIL SET VI 4964
539134-1ML PROTEASE INHIBITOR COCKTAIL SET III 951
539134-1SET PROTEASE INHIBITOR COCKTAIL SET III 4328
539136-1ML PROTEASE INHIBITOR COCKTAIL SET IV 1003
539136-1SET PROTEASE INHIBITOR COCKTAIL SET IV 3661
539137-10VL PROTEASE INHIBITOR COCKTAIL V, EDTA-FREE 3315
539137-1ML PROTEASE INHIBITOR COCKTAIL V, EDTA-FREE 535
539138-1ML PROTEASE INHIBITOR COCKTAIL SET VII 1137
539138-1SET PROTEASE INHIBITOR COCKTAIL SET VII 4964
539140-5MG PROTEASOME SUBSTRATE I, FLUOROGENIC 2758
539141-5MG PROTEASOME SUBSTRATE II, FLUOROGENIC 3159
539142-5MG PROTEASOME SUBSTRATE III, FLUOROGENIC 3360
539143-5MG PROTEASOME SUBSTRATE IV, FLUOROGENIC 2892
539145-100UG ANTI-20S PROTEASOME A1-SUBUNIT RB PAB 4636
539146-100UG ANTI-PROTEASOME ACT PA28A SUBUNIT RB PAB 4636
539147-100UG ANTI-PROTEASOME ACT PA700 SUB 10B RB PAB 4636
539148-100UG ANTI-PROTEASOME ACT 11S (PA28G) RB PAB 4446
539149-5MG PROTEASOME SUBSTRATE VI, FLUOROGENIC 1338
539154-10UG 20S PROTEASOME, RABBIT 4229
539158-1KTT 20S PROTEASOME ASSAY KIT, SDS-ACTIVATED 6243
539159-1KIT 26S PROTEASOME DEGRADATION KIT 6953
539160-1MG PROTEASOME INHIBITOR I 1304
539160-5MG PROTEASOME INHIBITOR I 3627
539161-5MG INSOLUTION(TM) PROTEASOME INHIBITOR I 3878
539162-1MG PROTEASOME INHIBITOR II 1204
539162-5MG PROTEASOME INHIBITOR II 3544
539163-100UG PROTEASOME INHIBITOR III 3861
539164-1SET PROTEASOME INHIBITOR SET 5767
539165-1SET PROTEASOME INHIBITOR SET II 6034
539166-100UL ANTI-19S PROTEASOME S2-SUBUNIT RB PAB 4446
539167-100UL ANTI-26S PROTEASOME S4-SUBUNIT RB PAB 4636
539168-200UL ANTI-19S PROTEASOME S5A-SUBUNIT RB PAB 4636
539169-100UL ANTI-19S PROTEASOME, S6-SUBUNIT RB PAB 4446
539171-100UL ANTI-26S PROTEASOME, S7-SUBUNIT RB PAB 4636
539175-5MG PROTEASOME INHIBITOR IV 3126
539176-1KIT PROTEASOME ISOLATION KIT, HUMAN 6815
539180-1KIT PROTEOEXTRACT PROTEIN PRECIPITATION KIT 3878
539183-100UG PROTEASOME INHIBITOR VIII, BETA-LACTAM 3 4513
539184-10MG PROTEASOME INHIBITOR IX, AM114 2240
539187-25MG Proteasome Inhibitor X, PI-083 1288
539202-5MG PROTEIN A, STAPHYLOCOCCUS AUREUS 2223
539206-5ML PROTEIN A AGAROSE 4594
539207-1ML PROTEIN G-AGAROSE 2048
539209-5MG PROTEIN ARG N-METHYLTRANSFERASE INHIBITO 1870
539211-50MG PROTEIN METHYLTRANSFERASE INHIBITORAMI-5 1475
539215-100UG PROTEIN C, HUMAN PLASMA 4897
539215-50UG PROTEIN C, HUMAN PLASMA 2842
539218-10UG PROTEIN C, ACTIVATED, HUMAN PLASMA 5031
539229-50UL ANTI-PROTEIN DISULFIDE ISOMERASE RB PAB 3715
539236-100UG PD ANTI-PKA SUBSTRATE MOUSE MAB (15B12) 4247
539251-1MG PROTEIN A, ALKALINE PHOSPHATASE 2858
539253-1MG PROTEIN A, PEROXIDASE 1956
539302-1MG PROTEIN G, STREPTOCOCCUS SP. 2641
539303-1MG PROTEIN G, RECOMB. 1304
539303-5MG PROTEIN G, RECOMB. 5265
539305-500UG PROTEIN G, ALKALINE PHOSPHATASE CONJ 2223
539322-500UG PROTEIN G, PEROXIDASE CONJ 2223
539406-100UG PROTEIN S, HUMAN PLASMA 2608
539470-10MG PROTEINASE K INHIBITOR 2649
539480-100MG PROTEINASE K, TRITIRACHIUM ALBUM 1137
539480-25MG PROTEINASE K, TRITIRACHIUM ALBUM 468
539481-100KU PKA, CATALYTIC SUB, MOUSE, RECOM 4563
539482-50UG PKA, HISTAG, ACTIVE, HU., RECOM 4998
539483-100UG PROTEINASE 3, HUMAN NEUTROPHILS 5382
539493-100U PP1, A-ISOFORM, RB, RECOM 4814
539494-50UL PROTEIN KINASE C, RAT BRAIN 4964
539508-1UG PROTEIN PHOSPHATASE 2A1, BOVINE KIDNEY 3845
539508-5UG PROTEIN PHOSPHATASE 2A1, BOVINE KIDNEY 8825
539509-100UL ANTI-PP2A/A (7-19) (PR65) RABBIT PAB 4900
539510-1UG PROTEIN PHOSPHATASE 2A2, BOVINE KIDNEY 5365
539513-200NG PKC, CATALYTIC SUBUNIT, RAT BRAIN 4129
539514-20KU PROTEIN PHOSPHATASE, LAMBDA, RECOMB. 3878
539515-1MG PROTHROMBIN, HUMAN PLASMA 2390
539515-2MG PROTHROMBIN, HUMAN PLASMA 4430
539516-20UG PPI-2, RABBIT MUSCLE, RECOMB. 3761
539517-100UL ANTI-PP1A, C-TERMINAL RABBIT PAB 4709
539521-100UL ANTI-PP2A/BA (14-27) (PR55) RABBIT PAB 4973
539522-5MG PKCE TRANSLOCATION INHIBITOR PEPTIDE 3009
539525-100UL ANTI-PP 2A/C (298-309) RABBIT PAB 4900
539530-100UL ANTI-PP2BA (482-494) RABBIT PAB 4973
539532-100UL ANTI-PROTEIN KINASE CD (662-673) RB PAB 4900
539535-100UL ANTI-PROTEIN KINASE CE (728-737) RB PAB 4900
539538-100UL ANTI-PROTEIN KINASE CZ (580-592) RB PAB 4900
539542-5MG PKCE TRANSLOCATION PEPTIDE, NEG CTRL 2892
539543-100UL ANTI-PP1G1, C-TERMINAL RABBIT PAB 4709
539550-100UL ANTI-PKCCONSENSUS (AC543-549) RB PAB 4914
539552-1UG PP2A INHIBITOR I1(PP2A), KIDNEY, RECOM 5311
539560-1MG PROTEIN KINASE C INHIBITOR PEPTIDE 19-36 4430
539560-500UG PROTEIN KINASE C INHIBITOR PEPTIDE 19-36 2474
539562-500UG PKCEPSILON PEPTIDE SUBSTRATE 2825
539563-500UG PROTEIN KINASE CD PEPTIDE SUBSTRATE 2257
539564-500UG PROTEIN KINASE CMU PEPTIDE SUBSTRATE 1605
539568-5000U PROTEIN PHOSPHATASE 2B, HUMAN, RECOMB. 5616
539569-50UG PP2C,ALPHA-ISOFORM,HISTAG,HU,REC,E.COLI 4697
539572-1SET SERINE/THREONINE KINASE INHIBITOR SET 6586
539573-1SET PROTEIN KINASE C INHIBITOR SET 7104
539576-25UG PROTEIN KINASE A, CATALYTIC SUBUNIT, BOV 5315
539577-50UG PKA, REGULATORY SUB. TYPE II, BOV. HEART 4500
539578-4UG PROTEIN KINASE G, I ALPHA, BOVINE LUNG 4630
539582-1MG PSA SUBSTRATE, FLUOROGENIC 2808
539601-500UL ANTI-PROTEIN KINASE CA (662-672) RB PAB 4622
539603-100UL ANTI-PROTEIN KINASE CBI (661-671) RABBIT 4900
539604-500UG PKCN PSEUDOSUBSTRATE INHIBITOR, MYRISOYL 3059
539605-500UL ANTI-PKCBII (661-673) RB PAB 4622
539607-500UL ANTI-PROTEIN KINASE CD (658-676) RB PAB 4622
539609-50UL ANTI-PROTEIN KINASE CE (721-737) RB PAB 4622
539610-500UG PKCZ PSEUDOSUBSTRATE INHIBITOR 2190
539611-500UL ANTI-PROTEIN KINASE CG (681-697) RB PAB 4622
539620-250NG PP 2A 2A INHIBITOR I2(PP2A), HU., REC 5179
539622-1MG PROTEIN KINASE BA SUBSTRATE 1471
539624-500UG PKCZ PSEUDOSUBSTRATE INHIBITOR, MYRISTOY 2792
539626-1MG PROTEIN KINASE G SUBSTRATE, GLASSTIDE 1521
539630-1SET PROTEIN PHOSPHATASE INHIBITOR SET II 5650
539636-500UG PKCQ PSEUDOSUBSTRATE INHIBITOR, MYRISTOY 3143
539638-100UG PROTEIN PHOSPHATASE INHIBITOR 2, RECOM 3744
539644-500UG UCN-01 2591
539645-500UG UCN-02 2591
539648-1MG STAUROSPORINE, N-BENZOYL 2875
539651-20UG PKCALPHA, HISTAG, HU, REC, S. FRUGIPERDA 3661
539651-5UG PKCALPHA, HISTAG, HU, REC, S. FRUGIPERDA 2023
539652-2MG PKC BETA II INHIBITOR/EGFR *CGP53353* 2106
539654-500UG PKC BETA INHIBITOR 2441
539655-20UG PROTEIN KINASE CBI, HU., RECOM 7287
539655-5UG PROTEIN KINASE CBI, HU., RECOM 4379
539657-20UG PROTEIN KINASE CBII, HU., RECOM 7388
539657-5UG PROTEIN KINASE CBII, HU., RECOM 5682
539658-20UG PROTEIN KINASE CBII, HUMAN, RECOMBINANT 5767
539658-5UG PROTEIN KINASE CBII, HUMAN, RECOMBINANT 3928
539660-20UG PROTEIN KINASE CEPSILON, HU., RECOM 7638
539661-50UG CIAP-1, HUMAN, RECOMBINANT, E. COLI 5583
539662-10UG HGF ACTIVATOR, HISTAG, HU., RECOM, NSO 6390
539663-100UG HTRA2/OMI, HUMAN, RECOMBINANT, E.COLI 5750
539664-10UG SERPIN F2/ALPHA2-ANTIPLASMIN, HIS TAG 6151
539665-20UG PROTEIN KINASE CG, HU., RECOM 7304
539666-500UG PROTEIN KINASE C SUBSTRATE, BIOTINYLATED 2608
539667-500UG PKCZ SUBSTRATE, BIOTINYLATED 2324
539672-20UG PROTEIN KINASE CD, HU., RECOM 7170
539672-5UG PROTEIN KINASE CD, HU., RECOM 4379
539677-5UG PKC, HISTAG, HU, REC, S. FRUGIPERDA 5048
539684-1MG PROTEIN KINASE A INHIBITOR 6-22 AMIDE 2006
539685-5UG PKCIOTA, GST-FUSION PROTEIN, RECOM 1822
539687-5UG PKCNU, GST-FUSION PROTEIN, HU., RECOM 1939
539690-25MG PROTEIN SYNTHESIS INITIATION INHIBITOR 2641
539720-1KIT PROTEOEXTRACT TISSUE DISSOCIATION BUFFER 4204
539722-1KIT PROTEOEXTRACT PHOSPHOPEPTIDE ENRICHMENT 14052
539723-1KIT PROTEOEXTRACT PHOSPHOPEPTIDE SCIMAC ENRI 4931
539731-200U PTPASE LAR, HU., RECOM 4012
539732-200U PTP, T-CELL, HU., RECOM 4012
539734-2000U PROTEIN TYROSINE PHOSPHATASE, YOP, RECOM 4012
539735-50UG PROTEIN TYROSINE PHOSPHATASE 1B, RECOM 6485
539736-1KIT PTP1B ASSAY KIT, COLORIMETRIC 6774
539737-1MG PTPASE 1B SUBSTRATE 3861
539738-500UG PTPASE SUBSTRATE II 5182
539739-1MG PTP 1B SUBSTRATE II 2808
539741-5MG PTP1B INHIBITOR 3143
539743-1EA INHIBITORSELECT 384-WELL PK LIBRARY I 101420
539744-1EA INHIBITORSELECT 96-WELL PK LIBRARY I 67233
539745-1EA INHIBITORSELECT 96-WELL PK LIBRARY II 67233
539746-1EA INHIBITORSELECT 96-WELL PK LIBRARY III 63732
539751-1SET PROTEOEXTRACT DETERGENT SET 7555
539779-1KIT PE COMPL. MAMM. PROTEOME EXTRACTION KIT 5165
539789-1KIT PE PART. MAMM. PROTEOME EXTRACTION KIT 6106
539790-1KIT PE SUBCELLULAR PROTEOME EXTRACTION KIT 6081
539791-1KIT PE SUBCELL. PROTEOME EXTRACTION KIT, MN 6001
539806-20UG PTP PRL-2, GST-FUSION 3544
539808-10MG PRL-3 INHIBITOR 2324
539832-100UG PROSTATE SPECIFIC ANTIGEN, HU. SEMINAL 5098
539834-100UG PROSTATE SPECIFIC ANTIGEN, ACTIVE 5666
539844-125U GOAT ANTI-RABBIT G-GLOBULIN 659
540025-50ML PLURONIC F-127, PROTEIN GR. 10% SOLUTION 2407
540200-10MG PTP INHIBITOR I 2207
540210-10MG PTPASE INHIBITOR III 2207
540211-10MG PTPASE INHIBITOR IV 1555
540213-10MG PTP INHIBITOR V, PHPS1 1972
540215-1MG PTPASE CD45 INHIBITOR 2524
540215-5MG PTPASE CD45 INHIBITOR 2117
540220-5MG PURMORPHAMINE 2741
540221-1MG PURINE NUCLEOSIDE PHOSPHORYLASE, RECOM 2106
540222-100MG PUROMYCIN, DIHCL 2624
540222-25MG PUROMYCIN, DIHCL 753
540223-5MG INSOLUTION PURMORPHAMINE 2558
540411-100MG PUROMYCIN, DIHCL, CELL CULTURE-TESTED 3026
540411-25MG PUROMYCIN, DIHCL, CELL CULTURE-TESTED 936
540500-1MG PURVALANOL A 1254
541330-100UG ANTI-PSTAIRE (42-57) RABBIT PAB 4695
5440-5GM PYRIDOXAL-5-PHOSPHATE 1588
545060-25GM PYRIDOXAL, HYDROCHLORIDE 2624
545068-5GM PYRIDOXAMINE, DIHYDROCHLORIDE 2390
545127-50U PROLYL ENDOPEPTIDASE, M. XANTHU.S, RECOM 7304
548000-100MG 1-PYRROLIDINECARBODITHIOIC ACID, AMMONI 619
549900-10T PD ANTI-PYK2 (PTYR402) RABBIT PAB 5017
549902-100UG PD ANTI-PYK2 (PTYR402) MOUSE MAB (14F6) 4900
5506-2500IU PYRUVATE KINASE, RABBIT MUSCLE 653
550701-100U PYRUVATE OXIDASE, AEROCOCCUS VIRIDANS 1939
551451-1MG PYY3-36, HUMAN 3544
551476-1MG INSOLUTION Q-VD-OPH, NON-O-METHYLATED 2741
551590-5MG QUERCETAGETIN 4112
551600-100MG QUERCETIN, DIHYDRATE 602
551826-50MG QUIN 2, TETRAPOTASSIUM SALT 6995
551850-100MG QUINACRINE, DIHCL 619
552097-100UG ANTI-RAB3A (1-18) RABBIT PAB 4636
552101-100UL ANTI-RAB9 MOUSE MAB (MAB9) 5788
552104-100UL ANTI-RAB4,HUMAN(RB) 4695
552108-50UL ANTI-RAB5 RABBIT PAB 4753
552109-50UL ANTI-RAB6 RABBIT PAB 4739
552126-50UL ANTI-RAB18 RABBIT PAB 4739
552233-100MG QX-314 1271
553003-500UG INSOLUTION(TM) RAF1 KINASE INHIBITOR 1187
553008-1MG RAF1 KINASE INHIBITOR I **GW5074** 1906
553009-10T PD ANTI-C-RAF (PTYR340, TYR341) RB PAB 5017
553010-100UG PD ANTI-C-RAF (PSER621) MOUSE MAB (6B4) 4900
553014-1MG RAF KINASE INHIBITOR IV *L-779,450* 2140
553015-1MG RAF KINASE INHIBITOR V 1640
553016-5MG Raf Kinase Inhibitor VI 1543
553210-100UG RAPAMYCIN 736
553210-10MG RAPAMYCIN 5311
553210-1MG RAPAMYCIN 3143
553211-500UG INSOLUTION(TM) RAPAMYCIN 1822
553212-1MG INSOLUTION RAPAMYCIN IN ETOH 3143
553215-1L RAPIDSTAIN REAGENT 2106
553325-100UG RAS,HU,RECOMB,WILD-TYPE 4179
553400-500UG RADICICOL, DIHETEROSPORA CHLAMYDOSPORIA 1455
553500-10UG RANTES, HUMAN, RECOMB. 3878
553502-10MG RAC1 INHIBITOR 3980
553502-5MG RAC1 INHIBITOR 4563
553504-10KU RAD51, HISTAG, HU., RECOM 6452
553506-50UG RAP, HUMAN, RECOMBINANT {E. COLI} 3761
553507-100UG ANTI-RAP MOUSE MAB (7F1) 3613
553508-5MG INSOLUTION(TM) RAC1 INHIBITOR 4262
553509-10MG RAS/RAC TRANSFORMATION BLOCKER, SCH51344 2140
553510-10MG RAD51-STIMULATORY COMPOUND-1, RS-1 1640
553511-10MG Rac1 Inhibitor II  849
553571-50UG ANTI-RAS (31-43) RABBIT PAB 2649
553590-2UG INSOLUTION(TM) RATJADONE A, SYNTHETIC 3627
553730-100UL ANTI-REELIN (40-189) MOUSE MAB (142) 4801
553731-50UL ANTI-REELIN (164-496) MOUSE MAB (G10) 4227
553850-100UG ANTI-RELAXIN 2 RABBIT PAB 4315
553901-150MIU RENIN, HUMAN KIDNEY 4825
554000-50UG REP-1, HISTAG, RAT, RECOMB. 4346
554101-100UL ANTI-RESISTIN RABBIT PAB 4900
554325-25MG RESVERATROL 769
554340-10MG RET RECEPTOR TYROSINE KINASE INHIBITOR 2469
554412-1MG TETRODOTOXIN, FUGU SP. 4112
554717-5MG REVERSINE 2741
554720-500MG TRANS-RETINOIC ACID 1254
554723-25MG ATRA-BA HYBRID 3017
554994-10MG RHC-80267 1505
555466-25UG RHOA,GST-FUSION,HU,RECOM 5533
555467-400UG RHOTEKIN RHO BINDING DOMAIN AGAROSE CONJ 5432
555505-50MG RHODAMINE 123 1722
555550-1MG RHO-KINASE INHIBITOR **H-1152** 3176
555550-5MG RHO-KINASE INHIBITOR **H-1152** 5311
555551-5MG RHO-KINASE INHIBITOR II 2457
555552-500UG INSOLUTION RHO KINASE INHIBITOR H-1152 1655
555553-10MG RHO KINASE INHIBITOR III, ROCKOUT 1638
555554-1MG RHO KINASE INHIBITOR IV 2875
555555-5MG RHO KINASE INHIBITOR V 3300
555558-25MG RHO/SRF PATHWAY INHIBITOR, CCG-1423 1984
555580-10MG RIBAVIRIN 936
555682-10GM RIBOFLAVIN 428
55674-10KU RIBONUCLEASE A, BOVINE PANCREAS 920
55674-50KU RIBONUCLEASE A, BOVINE PANCREAS 3761
556746-10KU RIBONUCLEASE A, PROTEASE-FREE, BOV PANCR 1471
556746-50KU RIBONUCLEASE A, PROTEASE-FREE, BOV PANCR 5616
556770-25MG RNASE L ACTIVATOR 1984
556785-5TU RIBONUCLEASE T1, ASPERGILLUS ORYZAE 4247
556881-2500U RIBONUCLEASE INHIBITOR, HU., RECOM 2476
55714-1GM RIBONUCLEIC ACID, YEAST 8267
55714-250MG RIBONUCLEIC ACID, YEAST 2038
557303-1GM RIFAMPICIN 1120
557303-5GM RIFAMPICIN 4379
557322-200UG RK-682, STREPTOMYCES SP. 1906
557324-50MG RILUZOLE 1555
557330-5MG ROLIPRAM 2474
557360-1MG ROSCOVITINE 669
557360-5MG ROSCOVITINE 2691
557362-1MG ROSCOVITINE, (S)-ISOMER 853
557364-5MG INSOLUTION(TM) ROSCOVITINE 2691
557368-1GM ROTENONE 1204
557370-10MG ROTTLERIN 1488
557400-10KU RNA POL II-CTD, RECOMBINANT, E. COLI 7956
557401-50MG RNA-EDITING LIGASE 1 INHIBITOR, NSC45208 1143
557403-10MG RNA POLYMERASE III INHIBITOR 3673
557440-1MG RU360 4814
557440-1SET RU360 6652
557440-500UG RU360 2758
557450-250MG RUTHENIUM RED 853
557502-100MG RO-20-1724 1120
557508-1MG RO-31-7549 1772
557514-1MG RO-31-8425 1772
557520-500UG RO-31-8220 1588
557521-500UG INSOLUTION(TM) RO-31-8220 1588
557525-1MG RO-32-0432 2257
557529-5UG ROCK2,GST-FUSION,HU.,REC,S. FRUGIPERDA 3611
557550-1MG RO106-9920 1338
557550-5MG RO106-9920 4663
558255-100GM SAPONIN 970
558300-500ML SEABLOCK REAGENT, SALMON PLASMA 2407
559240-50UG ANTI-RSEC6 MOUSE MAB (9H5) 3883
559270-25MG RB/RAF-1 DISRUPTOR 251 1475
559276-500UG RYANODINE, HIGH PURITY 2792
559279-50UG ANTI-RYANODINE RECEP(MOAB) 4739
559284-1MG S-100 PROTEIN, BOVINE BRAIN 4379
559285-1MG RSK INHIBITOR, SL0101 3423
559287-100UG S-100AA PROTEIN, BOVINE BRAIN 2775
559290-1MG S-100B PROTEIN, BOVINE BRAIN 6619
559291-500UG S-100 PROTEIN, HUMAN BRAIN 3895
559300-1MG SAFINGOL 2257
559303-5MG SANT-1 2023
559304-200UL ANTI-SAPK/JNK RABBIT PAB 4739
559307-1MG SANGIVAMYCIN 1605
559309-10T PD ANTI-SAPK/JNK (PTHR183,TYR185) RB PAB 6005
559313-1MG SANT-2, SMO I2-20 2303
559322-100UG ANTI-P38/SAPK 2A MOUSE MAB (20B11) 4900
559324-20UG P38A, HISTAG, HUMAN, RECOMBINANT,E. COLI 5950
559325-5UG P38DELTA, GST-FUSION PROTEIN, HU., RECOM 2875
559387-1MG SB 202474 1939
559388-1MG SB 202190 1772
559389-10MG SB 203580 3980
559389-1MG SB 203580 1653
559389-5MG SB 203580 2649
559393-1MG SB 202190, HYDROCHLORIDE 1889
559395-1MG SB 203580, HYDROCHLORIDE 1772
559396-500UG SB 220025, TRIHYDROCHLORIDE 2708
559397-1ML INSOLUTION(TM) SB 202190 2006
559398-1ML INSOLUTION(TM) SB 203580 2240
559399-1MG SB 203580, SULFONE 1822
559400-1MG SB 203580, IODO- 1856
559402-1MG SB-218078 2194
559404-500UG SB 239063 2040
559405-1MG SB 225002 1254
559406-1MG SB 328437 970
559406-5MG SB 328437 3861
559407-1MG SB 202474, DIHYDROCHLORIDE 2106
559410-10MG SB 290157 1789
559418-100MG SBHA 1354
560000-10ML SPUTOLYSIN REAGENT 535
560000-1SET SPUTOLYSIN REAGENT 4079
561300-50UG E-SELECTIN, HU., RECOM, CHO CELL LINE 5867
561303-50UG L-SELECTIN, HU., RECOM, CHO CELL LINE 7105
561306-50UG P-SELECTIN, HU., RECOM, CHO CELL LINE 5867
561505-1GM L-SELENOMETHIONINE 5299
561505-250MG L-SELENOMETHIONINE 2457
561506-50UG SENP1, HIS TAG, HUMAN, RECOMBINANT, E. C 2507
561507-50UG SENP2, HISTAG, HUMAN, RECOMBINANT, E. CO 2507
561508-25UG SENP5, HISTAG, HUMAN, RECOMBINANT, E. CO 3761
561509-5UG SENP6, HIS TAG, HUMAN, RECOMBINANT, E. C 3761
561510-5UG SENP7, HIS TAG, HUMAN, RECOMBINANT, E. C 3761
561511-50UG SENP8, HIS TAG, HUMAN, RECOMBINANT, E. C 3761
564702-100UL ANTI-SERCA2 ATPASE(MOAB) 4666
564970-100UL ANTI-SEK1/MKK4 (PTHR 261) RABBIT PAB 4900
565000-1VL SERINE PROTEASE INHIBITOR COCKTAIL SET I 1104
565000-5VL SERINE PROTEASE INHIBITOR COCKTAIL SET I 4446
5650-100GM L-SERINE 1137
565190-500UG SERUM AMYLOID P COMPONENT, HUMAN SERUM 3861
565191-1ML ANTI-SERUM AMYLOID P COMPONENT RB PAB 2735
565193-500UL SERUM AMYLOID P COMPONENT, NORMAL MO STD 5098
565610-5MG SC-560 1939
565625-1MG SC68376 2808
565645-10MG SCH-202676 1939
565715-1MG SCYTONEMIN, LYNGBYA SP. 1822
565725-5MG SECINH3 3310
565730-5MG SCRIPTAID 1789
565740-1MG A-APP MODULATOR 3252
565749-1MG B-SECRETASE INHIBITOR II 970
565749-5MG B-SECRETASE INHIBITOR II 3661
565750-1MG G-SECRETASE INHIBITOR I 2006
565755-1MG G-SECRETASE INHIBITOR II **MW167** 3276
565758-1MG B-SECRETASE SUBSTRATE IV, FLUOROGENIC 2457
565761-1MG G-SECRETASE INHIBITOR IV 1839
565762-1MG G-SECRETASE INHIBITOR V 1839
565763-5MG G-SECRETASE INHIBITOR VI 2792
565764-1MG G-SECRETASE SUBSTRATE, FLUOROGENIC 1822
565765-1MG G40-SECRETASE INHIBITOR I 1839
565767-1MG A-SECRETASE SUBSTRATE II, FLUOROGENIC 2357
565770-10MG G-SECRETASE INHIBITOR IX 1984
565770-5MG G-SECRETASE INHIBITOR IX 1789
565771-250UG INSOLUTION G-SECRETASE INHIBITOR X 4727
565771-500UG INSOLUTION G-SECRETASE INHIBITOR X 5311
565772-5MG G-SECRETASE INHIBITOR XI 1822
565773-5MG G-SECRETASE INHIBITOR XII 2909
565774-5MG G-SECRETASE INHIBITOR XIII 3226
565777-5MG G-SECRETASE INHIBITOR XVI 1789
565778-500UG INSOLUTION G-SECRETASE INHIBITOR XVII 2892
565780-500UG B-SECRETASE INHIBITOR III 1739
565781-500UG B-SECRETASE SUBSTRATE VI, FLUOROGENIC 5248
565784-5MG INSOLUTION G-SECRETASE INHIBITOR IX 1953
565785-1KIT B-SECRETASE ACTIVITY ASSAY KIT 8925
565787-100UG INSOLUTION(TM) G-SECRETASE INHIBITOR XIX 3226
565788-1MG B-SECRETASE INHIBITOR IV 2858
565789-500UG G-SECRETASE INHIBITOR XX 3838
565790-500UG GAMMA SECRETASE INHIBITOR XXI,COMPOUND E 3443
565850-10MG SHIKONIN 1354
565851-50MG SHP1/2 PTPASE INHIBITOR, NSC-87877 1572
565855-20UG PTP SHP-2, GST-FUSION 3544
565942-100UG ANTI-SIALYL LEWIS A MOUSE MAB (KM231) 5806
565950-1MG SIALYL LEWIS X, SODIUM SALT 2808
565950-5MG SIALYL LEWIS X, SODIUM SALT 9962
565952-100UG SIALYL LEWIS X-BSA, 14-ATOM SPACER 4783
565953-100UG ANTI-SIALYL LEWIS X MOUSE MAB (KM93) 5894
566219-100UL ANTI-A2,3-(N)-SIALYLTRANSFERASE RB PAB 2808
566223-100MIU A2,6-(N)-SIALYLTRANSFERASE,HU,REC.,S.FR 3928
566227-100MIU A2,3-(O)-SIALYLTRANSFERASE, RAT, RECOMB. 1889
566310-100UG ANTI-SIRPA1, C-TERMINAL (487-503) RB PAB 4037
566320-5MG SIRTINOL 3092
566321-1MG INSOLUTION(TM) SIRTINOL 1225
566322-5MG SIRT1 INHIBITOR III *EX-527* 3310
566323-5MG SIRT1/2 INHIBITOR IV, CAMBINOL 2591
566324-5MG SIRT2 INHIBITOR, AGK2 2324
566325-500UG SIRT1 INHIBITOR IV, (S)-35 1423
566326-5MG SIRT2 INHIBITOR, INACTIVE CONTROL, AGK7 2324
566327-10MG SIRT1/2 INHIBITOR VII 1116
566328-1KIT HDAC ACTIVITY ASSAY KIT 8266
566329-1KIT SIRT2 ACTIVITY ASSAY KIT 10088
566330-10MG SIRT1/2 INHIBITOR VIII, SALERMIDE 1972
566331-10MG SIRT2 Inhibitor II, AK-1  989
566380-10ML NORMAL GOAT SERUM, LYOPHILIZED SOLID 1718
566400-5ML NORMAL GUINEA PIG SERUM, LYO. SOLID 1076
566405-1MG SMAD3 INHIBITOR, SIS3 2223
566411-50UG PD ANTI-SMAD1 (PSER463/465) RABBIT PAB 4636
566414-50UG ANTI-SMAD3 (206-220) RABBIT PAB 2808
566415-50UL PD ANTI-SMAD2 (PSER465/467) RABBIT PAB 3832
566416-100UG ANTI-SMAD1 RABBIT PAB 4066
566418-50UG SMAD3, GST-FUSION, HUMAN, RECOMBINANT 3761
566460-5ML NORMAL DONKEY SERUM, STERILE 1187
566660-1MG SMOOTHENED AGONIST, SAG 3476
566661-500UG INSOLUTION SMOOTHENED AGONIST, SAG 1972
566701-250UG SERUM AMYLOID A PROTEIN-RICH, HDL, SERUM 4229
566806-100UG ANTI-SHP-1 MOUSE MAB (1SH01) 4168
566807-1SET PD ANTI-SHC/P66 (PSER36) MO MAB (6E10) 8346
567020-50MG SIMVASTATIN 3159
567021-5MG SIMVASTATIN, SODIUM SALT 2868
567028-20MG SIN-1, HCL 1555
567051-2MG INSOLUTION(TM) SINEFUNGIN 2691
567060-500UG SIOMYCIN A, STREPTOMYCES SIOYAENSIS 4291
567152-25GM BETA-SITOSTEROL 2324
567152-5GM BETA-SITOSTEROL 585
567300-1GM SKF-525A, HCL 4012
567305-5MG SKF-86002 2290
567310-5MG SKF-96365, HCL 2023
567333-200NMOL SNAPTIDE BOTOX A SUBSTRATE, FLUOR. 7956
567360-100UG ANTI-SMAC/DIABLO RAT MAB (10G7) 5104
567365-100UG ANTI-SMAC/DIABLO (222-237) RABBIT PAB 3861
567370-1MG SMAC-N7 PEPTIDE 1087
567370-5MG SMAC-N7 PEPTIDE 4346
567375-1MG SMAC-N7 PEPTIDE, CELL-PERMEABLE 3895
567418-500GM SODIUM ACETATE, ANHYDROUS, MB GRADE 519
567422-100ML SODIUM ACETATE, 3 M, PH 5.2, MB GRADE 836
567430-250MG SODIUM BUTYRATE 769
567440-1KG SODIUM CHLORIDE 702
567440-500GM SODIUM CHLORIDE 485
567441-500GM SODIUM CHLORIDE, MB GRADE 903
567441-5KG SODIUM CHLORIDE, MB GRADE 2023
567442-1EA SODIUM CHLORIDE TABLETS 602
567443-100ML SODIUM CHLORIDE,5 M,MBG,DEPC-TREATED 702
567446-100GM SODIUM CITRATE, 2H2O, MB GRADE 301
567446-1KG SODIUM CITRATE, 2H2O, MB GRADE 769
567446-5KG SODIUM CITRATE, 2H2O, MB GRADE 2591
567500-5MG NA+/H+ EXCHANGER ISOFORM-1 INHIBITOR 1689
567530-250GM SODIUM HYDROXIDE, PELLETS 619
567530-500GM SODIUM HYDROXIDE, PELLETS 1581
567538-100MG SODIUM NITROPRUSSIDE, DIHYDRATE 569
567540-5GM SODIUM ORTHOVANADATE 669
567545-1KG SODIUM PHOSPHATE, MONOBASIC 1455
567545-500GM SODIUM PHOSPHATE, MONOBASIC 936
567547-1KG SODIUM PHOSPHATE, DIBASIC, MB GRADE 1789
567547-250GM SODIUM PHOSPHATE, DIBASIC, MB GRADE 652
567549-1KG NA PHOSPHATE, MONOBASIC,H2O, MB GRADE 2240
567549-250GM NA PHOSPHATE, MONOBASIC,H2O, MB GRADE 753
567550-1KG SODIUM PHOSPHATE, DIBASIC 2091
567550-500GM SODIUM PHOSPHATE, DIBASIC 920
56755-1KG SORBITOL 853
567565-1GM SODIUM STIBOGLUCONATE 1388
567570-10GM SPECTINOMYCIN, DIHYDROCHLORIDE, PENTAHYD 2324
567616-100MG SODIUM 4-PHENYLBUTYRATE 870
567630-5GM SODIUM SALICYLATE 602
56766-5GM SPERMIDINE, TRIHCL 2708
567692-1KG L(-)SORBOSE 40206
567692-250GM L(-)SORBOSE 9316
567703-10MG SPERMINE NONOATE 602
567704-250MIU SPHINGOLIPID CERAMIDE N-DEACYLASE 4563
567706-100MG SPHINGOMYELIN, BOVINE SPINAL CORD 1672
567707-10U SPHINGOMYELINASE, STAPHYLOCOCCUS AUREUS 2223
567715-1MG N-SMASE INHIBITOR, GW4869 2725
567726-10MG D-ERYTHRO-SPHINGOSINE, HIGH PURITY 1588
567727-1MG D-ERYTHRO-SPHINGOSINE-1-PHOSPHATE 2658
567731-10MG SPHINGOSINE KINASE INHIBITOR 1605
567733-1MG S1P1 RECEPTOR AGONIST, SEW2871 2324
567733-5MG S1P1 RECEPTOR AGONIST, SEW2871 6151
567735-10MG SPHINGOSYLPHOSPHORYLCHOLINE 3939
567738-10UG SPHINGOSINE KINASE 1, HIS*TAG, HUMAN REC 6602
567739-10UG SPHINGOSINE KINASE 2, HIS*TAG, HUMAN REC 6602
567750-5MG SPLITOMICIN 1906
5677-5GM SPERMINE, TETRAHCL 2792
567780-2PACK SSC BUFFER, 20X POWDER PACK, ULTROL 953
567782-1EA SSPE BUFFER TABLETS 1254
567790-5MG ST638 2620
567805-1MG SRC KINASE INHIBITOR I 1989
567806-5MG SRC KINASE INHIBITOR II 2825
567816-1SET SRC-FAMILY PROTEIN TYROSINE K INHIB SET 5282
567822-100UL ANTI-SRC-3 RABBIT PAB 4900
568112-1KIT IM STAIN B/STREPT KIT ANTI-RB IGG, PEROX 4847
568500-5MG SQ 22536 1956
569372-100UG PD ANTI-SRC (PTYR418) MOUSE MAB (9A6) 6562
569373-10T PD ANTI-SRC (PTYR418) RABBIT PAB 5587
569374-10T PD ANTI-SRC (PTYR529) RABBIT PAB 6521
569383-10T PD ANTI-STAT1 (PSER727) RABBIT PAB 5017
569384-1SET PD ANTI-STAT3 (PTYR705) MOUSE MAB (9E12) 4900
569385-500UG SQI-PR 2775
569386-10T ANTI-STAT1 RABBIT PAB 4739
569388-100UL ANTI-STAT3 RABBIT PAB 4724
569390-100UG STATHMIN, HUMAN, RECOMBINANT, E. COLI 5650
569391-100UL ANTI-STATHMIN RABBIT PAB 4973
569392-10T PD ANTI-STAT3 (PSER727) RABBIT PAB 5017
569393-500UG STAUPRIMIDE 2580
569396-100UG INSOLUTION STAUROSPORINE, STREPTOMYCES 1672
569397-100UG STAUROSPORINE, STREPTOMYCES SP. 1672
569397-1MG STAUROSPORINE, STREPTOMYCES SP. 10379
569397-250UG STAUROSPORINE, STREPTOMYCES SP. 3611
569398-100GM STEARIC ACID 4335
569398-25GM STEARIC ACID 1555
569399-10MG 1-STEAROYL-2-ARACHIDONOYL-SN-GLYCEROL 1739
569404-2ML STREPTAVIDIN, BETA-GALACTOSIDASE CONJ 3326
569600-10UG STEM CELL FACTOR, HUMAN, RECOMB. 6485
569615-10MG STEM-CELL FACTOR/C-KIT INHIBITOR, ISCK03 2137
569620-5MG STEM CELL PROLIFERATION INHIBITOR 2374
569737-1KIT SIRT1 ACTIVITY ASSAY KIT 10088
569744-1EA STEMSELECT(TM) 384-WELL LIBRARY I 66488
570100-5MG STE11 MAPKKK ACTIVATION INHIBITOR 2758
570110-10MG STEROIDOGENIC FACTOR-1 INHIBITOR 2090
570250-5MG STO-609 3326
5711-100GM STREPTOMYCIN SULFATE, STREPTOMYCES SP. 920
572201-1GM STREPTOZOTOCIN 2457
572201-250MG STREPTOZOTOCIN 936
572300-10UG STROMAL CELL-DERIVED FACTOR 1ALPHA, HU. 4914
572630-1MG SU5402 5148
572630-2MG SU5402 5311
572630-500UG SU5402 2708
572631-500UG SU5402 INSOLUTION 2524
572632-1MG SU5614 2307
572635-1MG SU6656 2290
572636-500UG INSOLUTION(TM) SU6656 1555
572650-5MG SU9516 1856
572660-500UG SU11652 7224
572888-5MG SU1498 2357
572909-100MG SUBTILISIN CARLSBERG, B. LICHENIFORMIS 1605
573080-25MG STAT1 ENHANCER, 2-NP 2407
573092-2MG STAT3 INHIBITOR PEPTIDE II, ERBB2-SELECT 7909
573094-2MG P3-AHNP PEPTIDE CARRIER NEGATIVE CONTRO 4012
573095-1MG STAT3 INHIBITOR PEPTIDE 2407
573096-1MG STAT3 INHIBITOR PEPTIDE, CELL-PERMEABLE 2708
573096-5MG STAT3 INHIBITOR PEPTIDE, CELL-PERMEABLE 11249
573097-10MG STAT3 INHIBITOR III, WP1066 2140
573098-10MG JAK2 INHIBITOR III, SD-1029 2240
573099-25MG STAT3 INHIBITOR V, STATTIC 2858
573100-100MG SATA 1398
573102-10MG STAT3 INHIBITOR VI, S3I-201 2401
573103-5MG STAT3 INHIBITOR VII 2303
573105-5MG STAT3 INHIBITOR PEPTIDE,CELL-PERMEABLE,I 4788
573106-1MG  STAT3 Inhibitor X, HJB 1933
573108-10MG STAT5 INHIBITOR 1505
573109-25MG STAT3 INHIBITOR VIII, 5,15-DPP 1659
573112-50MG SPDP 1488
573113-0.5KG SUCROSE, MB GRADE 552
573113-1KG SUCROSE, MB GRADE 736
573113-5KG SUCROSE, MB GRADE 2190
573114-100MG SMCC 2354
573114-50MG SMCC 1398
573115-50MG SMCC, WATER-SOLUBLE 2073
573117-5MG SMC PROLIFERATION INHIBITOR-2W 1555
573121-10MG SMER28 2340
573125-10MG STAT3 INHIBITOR IX, CPD188 1256
573462-25MG SUCCINYL-ALA-ALA-PRO-PHE-P-NITROANILIDE 953
5737-1KG SUCROSE 836
573822-100UL ANTI-SYNAPTOPHYSIN MOUSE MAB (SP15) 4680
573824-200UG ANTI-SYNAPTOTAGMIN (AB-1) MO MAB (ASV30) 4695
573828-50UG ANTI-SYNAPTOTAGMIN I (1-23) RABBIT PAB 2649
573831-100UG ANTI-SYNTAXIN MOUSE MAB (SP6) 4695
573902-100UG ANTI-SYNAPSE-ASSOC PROT 102 MO MAB (7D3) 4695
574102-5MG SULINDAC SULFIDE 1254
574105-5MG SULINDAC SULFONE 1254
574215-25MG D,L-SULFORAPHANE 2892
574590-1KTT SUPEROXIDE ANION DETECTION KIT, CHEMILUM 6909
574591-100UG SUPEROXIDE DISMUTASE, HU., RECOM 6151
574593-50KU SUPEROXIDE DISMUTASE, BOVINE LIVER 1605
574594-50KU SUPEROXIDE DISMUTASE, BOV. ERYTHROCYTES 1755
574596-1ML ANTI-SOD (MN ENZYME) SHEEP PAB 2428
574597-1ML ANTI-SOD (CU/ZN ENZYME) SHEEP PAB 2428
574601-1KIT SUPEROXIDE DISMUTASE ASSAY KIT II 7647
574625-200MG SURAMIN, SODIUM SALT 2056
574625-50MG SURAMIN, SODIUM SALT 619
574660-50UG ANTI-SURVIVIN RABBIT PAB 4037
574711-5MG SYK INHIBITOR 1956
574712-1MG SYK INHIBITOR II 6190
574713-50MG SYK INHIBITOR III 1521
574714-2MG SYK INHIBITOR IV, BAY 61-3606 2407
574775-500UG SWAINSONINE, SWAINSONA CANESCENS 1137
574776-10UG SWINHOLIDE A, THEONELLA SWINHOEI 2591
574777-10UG ANTI-SYNAPSIN I RABBIT PAB 4475
574778-50UL ANTI-SYNAPSIN I RABBIT PAB 4973
574779-100UL ANTI-SYNAPSIN II (52-65) RABBIT PAB 4695
574784-200UG ANTI-SYNTAXIN 1 RABBIT PAB 5060
574786-100UG ANTI-SYNTAXIN 2 (1-19) RABBIT PAB 4695
574787-1SET ANTI-SYNTAXIN 3 RABBIT PAB 2925
574788-1SET ANTI-SYNTAXIN 4 RABBIT PAB 2925
574793-1L TE BUFFER, 100X, MOLECULAR BIOLOGY GRADE 2040
574795-1L TBE BUFFER, 10X, MOLECULAR BIOLOGY GRADE 669
574796-2PACK TBE BUFFER, 10X POWDER PACK, ULTROL GRAD 1053
574797-1L TAE BUFFER, 10X, MOLECULAR BIOLOGY GRADE 652
574798-5MG SYNAPTOGREEN REAGENT 4410
574799-5MG SYNAPTORED REAGENT 4501
574900-1SET TBP, HIS.TAG, HUMAN, RECOMB. E. COLI 6110
575000-100UL ANTI-A-SYNUCLEIN,C-TERM (116-131) GT PAB 3803
575001-200UG A-SYNUCLEIN, HUMAN, RECOMBINANT, E. COLI 4831
575003-200UG A-SYNUCLEIN A53T, HU., RECOM 5950
575142-100UL PD ANTI-STAT5 (PTYR694) RABBIT PAB 4900
575143-100UL PD ANTI-STAT6 (PTYR641) RABBIT PAB 4900
575303-5MG T ANTIGEN, P-NITROPHENYL- 5516
575305-5MG T0070907 1772
575307-10MG T113242 2023
575310-10MG T0901317 1956
575544-55ML TACHISORB IMMUNOADSORBENT, RABBIT 1455
577801-100UG ANTI-TAU MOUSE MAB (TAU-5) 6861
577802-10T PD ANTI-TAU (PSER199,SER202) RABBIT PAB 5236
577810-10T PD ANTI-TAU (PTHR212) RABBIT PAB 5017
577811-10T PD ANTI-TAU (PSER214) RABBIT PAB 5017
577813-10T PD ANTI-TAU (PTHR231) RABBIT PAB 5017
577814-10T PD ANTI-TAU (PSER262) RABBIT PAB 5017
577815-10T PD ANTI-TAU (PSER396) RABBIT PAB 5017
577817-10T PD ANTI-TAU (PSER422) RABBIT PAB 5644
579000-100MG TAMOXIFEN CITRATE 803
579002-5MG TAMOXIFEN, 4-HYDROXY-, (Z)- 3084
579050-1MG TAPI-0 5048
579051-1MG TAPI-1 5048
579052-1MG TAPI-2 5048
579053-500UG INSOLUTION TAPI-1 2591
579110-100UL ANTI-TAP1 (735-748) RABBIT PAB 4183
580217-25GM TAUROCHOLIC ACID, SODIUM SALT 5382
580217-5GM TAUROCHOLIC ACID, SODIUM SALT 1471
580218-1GM TAUROCHOLIC ACID, SODIUM , ULTROL 1053
580218-5GM TAUROCHOLIC ACID, SODIUM , ULTROL 4062
580221-50GM TAURODEOXYCHOLIC ACID, SODIUM SALT 6318
580221-5GM TAURODEOXYCHOLIC ACID, SODIUM SALT 1003
580549-1GM TAUROURSODEOXYCHOLIC ACID, SODIUM SALT 1488
580549-5GM TAUROURSODEOXYCHOLIC ACID, SODIUM SALT 5666
580551-50UG TAUTOMYCIN, S. SPIROVERTICILLATUS 4179
580553-25MG (+/-)-TAXIFOLIN HYDRATE 1254
580555-100MG PACLITAXEL, TAXUS SP. 20959
580555-25MG PACLITAXEL, TAXUS SP. 5633
580555-5MG PACLITAXEL, TAXUS SP. 1455
580556-5MG PACLITAXEL, SEMI-SYNTHETIC 1254
580559-20NMOL PACLITAXEL, 6A-HYDROXY- 1455
580560-1GM TCEP, HCL 953
580561-1ML TCEP, NEUTRAL 1287
580563-25MG TCPOBOP 2106
580566-10MG TENOVIN-1 1143
581004-150NMOL OMERASE INHIBITOR III, SODIUM SALT 1649
581006-100NMOL OMERASE INHIBITOR VI, SODIUM SALT 2842
581011-10MG OMERASE INHIBITOR IX 1906
581227-10UG SEX HORMONE BINDING GLOBULIN, HUMAN 2574
581420-50UG ANTI-TRF-1 RABBIT PAB 4666
581500-500MG TEMPOL 1053
581810-2MG TERREIC ACID, SYNTHETIC 1906
582000-100UL ANTI-OMERASE (AB-1) RABBIT PAB 4768
582005-100UL ANTI-OMERASE (AB-2) RABBIT PAB 4885
582231-25UG TETANUS TOXOID, CLOSTRIDIUM TETANI 3807
582235-10UG TETANUS TOXIN, C-FRAGMENT, C. TETANI 9872
582243-25UG TETANUS TOXIN, CLOSTRIDIUM TETANI 2892
583411-10GM TETRACYCLINE, HCL, CELL CULTURE TESTED 753
583411-25GM TETRACYCLINE, HCL, CELL CULTURE TESTED 1087
583411-50GM TETRACYCLINE, HCL, CELL CULTURE TESTED 1956
58346-10GM TETRACYCLINE, HCL 552
58346-25GM TETRACYCLINE, HCL 753
58346-50GM TETRACYCLINE, HCL 1388
584110-20MG TETRAHYDROBIOPTERIN DIHCL 1287
584222-10MG TETRAHYDROURIDINE 1471
584408-50MG TETRANDRINE 1003
585207-2PACK TG-SDS BUFFER, 10X POWDER PACK, ULTROL 953
585350-100UG ANTI-TFF3, HUMAN (MOUSE) 4973
585970-100MG (+/-)-THALIDOMIDE 1638
586005-1MG THAPSIGARGIN 1739
58656-2500KU THERMOLYSIN, B. THERMOPROTEOLYTICUS 2886
5871-100GM THIAMINE, HCL 753
595501-5MG THIOGLO 1 FLUORESCENT THIOL REAGENT 3036
595504-10MG THIOL FLUORESCENT PROBE IV 1584
595504-10MG  Thiol Fluorescent Probe IV 2285
596105-100MG THIOLYTE, MB 4944
596105-250MG THIOLYTE, MB 8306
596105-25MG THIOLYTE, MB 1398
596200-500MG THIOFLAVIN T 970
598101-100UG THIOREDOXIN, HUMAN, RECOMB. 4998
598226-10GM THIOSTREPTON 9544
598226-1GM THIOSTREPTON 1471
598250-1GM THP 836
598502-100UG THIOREDOXIN REDUCTASE, YEAST, RECOM 3510
598510-10MG DL-THIORPHAN 3793
604980-100U THROMBIN, BOVINE, HIGH ACTIVITY 1104
604980-500U THROMBIN, BOVINE, HIGH ACTIVITY 4446
605157-1KU THROMBIN, BOVINE 702
605160-1KU THROMBIN, PLASMINOGEN-FREE, BOVINE 1705
605190-1000U THROMBIN, HUMAN PLASMA 5616
605190-100U THROMBIN, HUMAN PLASMA 870
605195-1000U THROMBIN, HUMAN PLASMA, HIGH ACTIVITY 4630
605195-100U THROMBIN, HUMAN PLASMA, HIGH ACTIVITY 1003
605195-5000U THROMBIN, HUMAN PLASMA, HIGH ACTIVITY 16062
605197-50UG THROMBIN-ACTIVATABLE FIBRINOLYSIS INHIB 6485
605204-1ML THROMBIN, IMMOBILIZED, HUMAN PLASMA 3159
605206-100U THROMBIN, CITRATE-FREE, HUMAN PLASMA 870
605208-500UG THROMBIN RECEPTOR AGONIST 3911
605211-25MG THROMBIN SUBSTRATE III, FLUOROGENIC 1304
605218-5UG THROMBOPOIETIN, HUMAN, RECOMB. 5850
605225-25UG THROMBOSPONDIN, HUMAN PLAETS 2858
605230-1ML ANTI-THROMBOSPONDIN RABBIT PAB 2881
6060-5GM THYMIDINE 803
608050-10MG TAS-301 1822
608050-25MG TAS-301 3911
609270-100UL ANTI-THYMOSIN B4 RABBIT PAB 4315
609310-100MG THYROGLOBULIN, BOVINE THYROID GLAND 1772
609312-1MG THYROGLOBULIN, HUMAN THYROID 1287
609315-5MG THYROID HORMONE RECEPTOR ANTAGONIST 2223
609385-5IU TSH, BOV. PITUITARY 5081
610200-50UG ANTI-TIE1, C-TERMINAL RABBIT PAB 4607
610204-50UG ANTI-TIE2, N-TERMINAL RABBIT PAB 4607
610205-50UG ANTI-TIE2 MOUSE MAB (AB33) 2896
612075-250UG THYROXINE-BINDING GLOBULIN, HUMAN 4430
612080-5UG TIMP-1, HUMAN NEUTROPHIL GRANULOCYTE 4179
612084-5UG TIMP-2, HU. RHEUMATOID SYNOVIAL FIBRO 8190
612085-5MG TIE2 KINASE INHIBITOR 3260
612100-1MG PARP INHIBITOR X, TIQ-A 1471
612151-25UG TISSUE FACTOR, APO-, HUMAN, RECOMBINANT 11081
612161-500UG ANTI-TISSUE FACTOR MOUSE MAB (TF9-10H10) 17272
612200-100UG TISSUE PLASMINOGEN ACTIVATOR, HUMAN 3945
612200-1MG TISSUE PLASMINOGEN ACTIVATOR, HUMAN 10463
613225-50MG TJU103 1455
613420-50GM DL-ALPHA-TOCOPHEROL 723
613424-1SET TOCOPHEROL SET 9243
613450-5MG TOFA 3895
613544-100ML 3,3',5,5'-TETRAMETHYLBENZIDINE, SOLUBLE 853
613546-25MG TMB-8, HCL 903
613548-100ML 3,3',5,5'-TETRAMETHYLBENZIDINE, INSOL. 1170
613560-25MG TMPYP4 1354
613570-1MG TIRAP INHIBITOR PEPTIDE, CELL-PERMEABLE 3845
613571-1MG TIRAP INHIBITOR PEPTIDE, CONTROL, CELL-P 3845
613805-50MG TN-16 2190
613810-10MG TNAP Inhibitor 889
614005-100MG TOBRAMYCIN, FREE BASE 953
614320-1MG TLR7 LIGAND II *SM-360320 2507
614350-25MG TOMATIDINE, HCL 870
614850-1SET TOPOISOMERASEI,HISTAG,HUMAN,WILDTYPE,REC 6110
615700-1KIT TOTAL ANTIOXIDANT STATUS ASSAY KIT 10831
616360-500UL ANTI-TOXIN A GOAT PAB 2823
616365-5MG TRANSDERMAL HORMONE DELIVERY PEPTIDE 3560
616370-100MG APROTININ, BOVINE LUNG, CRYSTALLINE 5767
616370-10MG APROTININ, BOVINE LUNG, CRYSTALLINE 920
616370-20MG APROTININ, BOVINE LUNG, CRYSTALLINE 1521
616371-1MG APROTININ, BOV., RECOM, ANIMAL-FREE 970
616371-25MG APROTININ, BOV., RECOM, ANIMAL-FREE 2691
616371-5MG APROTININ, BOV., RECOM, ANIMAL-FREE 1338
616373-1MG TPL2 KINASE INHIBITOR 2324
616374-100UG TRAIL, HUMAN, RECOMBINANT, E. COLI 6452
616376-10UG TRAIL, HUMAN, RECOMB. NSO CELLS 6268
616377-2UG TOXIN B, CLOSTRIDIUM DIFFICILE 6651
616378-100UG ANTI-TRAIL, C-TERMINAL (261-277) RB PAB 4037
616379-2UG TOXIN A, CLOSTRIDIUM DIFFICILE 3761
616380-200UL ANTI-TRAIL R2, N-TERMINAL (68-94) GT PAB 4724
616382-250MG N(A)-TOSYL-LYS CHLOROMETHYL KETONE, HCL 2805
616382-50MG N(A)-TOSYL-LYS CHLOROMETHYL KETONE, HCL 1018
616383-100UL ANTI-TRAIL R-3, N-TERM (73-103) GT PAB 4826
616385-250UG A-TOXIN, STAPHYLOCOCCUS AUREUS 5709
616387-1GM N(A)-TOSYL-PHE CHLOROMETHYL KETONE 2505
616387-250MG N(A)-TOSYL-PHE CHLOROMETHYL KETONE 904
616390-100UG TOXIN II, ANEMONIA SULCATA 1672
616394-100MG TPEN 1521
616395-100MG TRANSFERRIN, APO-, HUMAN PLASMA 1187
616396-100UG ANTI-TRAIL R-4 (249-263) RABBIT PAB 4212
616397-100MG TRANSFERRIN, HOLO, HUMAN PLASMA 936
616397-500MG TRANSFERRIN, HOLO, HUMAN PLASMA 3544
616399-100KU APROTININ, BOVINE LUNG, SOLUTION 2040
616399-500KU APROTININ, BOVINE LUNG, SOLUTION 5898
616400-10MG TRANILAST 2432
616403-500UG TACE SUBSTRATE III, FLUOROGENIC 4480
616404-1MG TPL2 KINASE INHIBITOR II 4635
616407-1MG TACE SUBSTRATE IV, FLUOROGENIC 2725
616419-10MG TRANSFERRINAPO-,HUMANPLASMA,LOWENDOTOXIN 652
616420-100MG TRANSFERRIN, HOLO, BOVINE PLASMA 1020
616423-1ML ANTI-TRANSFERRIN GOAT PAB 922
616424-100MG TRANSFERRIN, HOLO, HUMAN PLASMA, LOW END 1371
616430-100UG TRANSFORMING GROWTH FACTOR-A, RECOM 6870
616450-1UG TRANSFORMING GROWTH FACTOR-B1, PLAETS 5449
616451-5MG TGF-BETA RI KINASE INHIBITOR 2023
616452-1MG TGF-B RI KINASE INHIBITOR II 1975
616452-2MG TGF-B RI KINASE INHIBITOR II 1451
616453-2MG TGF-BETA RI KINASE INHIBITOR III 2324
616454-2MG TGF-BETA RI KINASE INHIBITOR IV*A-83-01* 2240
616455-2UG TRANSFORMING GROWTH FACTOR-B1, RECOM 6051
616456-2MG TGF-BETA RI KINASE INHIBITOR V 1872
616458-5MG TGF-BETA RI KINASE INHIBITOR VII 2469
616459-2MG TGF-BETA RI KINASE INHIBITOR VIII 1981
616460-1UG TRANSFORMING GROWTH FACTOR-B1, PIG PLAT 5014
616465-500UL ANTI-TRANSGLUTAMINASE II RABBIT PAB 4315
625625-50GM TREHALOSE, DIHYDRATE 1053
625718-1L TRIETHYLAMMONIUM ACETATE, 1 M SOLUTION 3510
625725-100UL PD ANTI-TRKA (PTYR490) RABBIT PAB 5119
627609-1MG INSOLUTION CASPASE INHIBITOR I 3544
627610-1MG CASPASE INHIBITOR I 3544
627610-5MG CASPASE INHIBITOR I 5311
627624-5MG D-VAL-PHE-LYS CHLOROMETHYL KETONE, DIHCL 2507
627724-100UL ANTI-VAMP2 (36-56) RABBIT PAB 4914
627850-250MG VANCOMYCIN, HCL, STREPTOMYCES ORIENTALIS 970
641730-500GM TRICHLOROACETIC ACID 1471
64245-250MG L-3,3',5-TRIIODOTHYRONINE, SODIUM SALT 1120
642511-10MG L-3,3',5-TRIIODOTHYRONINE, FREE ACID 1120
645897-5MG TRIOXSALEN, 4'-AMINOMETHYL-, HCL 1555
645900-1MG TRIPTOLIDE, TRIPTERYGIUM WILFORDII 1354
645900-5MG TRIPTOLIDE, TRIPTERYGIUM WILFORDII 5716
647925-1MG TRICHOSTATIN A, STREPTOMYCES SP. 3009
647926-500UG INSOLUTION TRICHOSTATIN A, STREPTOMYCES 1689
647950-1GM TRICLOSAN 1003
648310-2.5KG TRIS BASE, MOLECULAR BIOLOGY GRADE 4714
648310-500GM TRIS BASE, MOLECULAR BIOLOGY GRADE 1338
648311-1KG TRIS BASE, ULTROL GRADE 1371
648311-5KG TRIS BASE, ULTROL GRADE 4797
648313-1KG TRIS, HCL, ULTROL GRADE 2574
648313-250GM TRIS, HCL, ULTROL GRADE 1003
648313-500GM TRIS, HCL, ULTROL GRADE 1672
648314-100ML TRIS BUFFER, 1 M, PH 8.0, MB GRADE 753
648315-100ML TRIS BUFFER, 100 MM, PH 7.4, MB GRADE 753
648317-100GM TRIS, HCL, MB GRADE 736
648317-1KG TRIS, HCL, MB GRADE 3360
648450-1MG TRKA INHIBITOR 1856
648462-1KG TRITON X-100 DETERGENT 1053
648462-3KG TRITON X-100 DETERGENT 2023
648463-50ML TRITON X-100, PROTEIN GR. 10% SOLUTION 1221
648464-10ML TRITON X-100, HYDROGENATED, 10% SOL. 1338
648465-10GM TRITON X-100 DETERGENT, HYDROGENATED 3903
648466-50ML TRITON X-100 DETERGENT, MB GRADE 351
648468-50ML TRITON X-114, PROTEIN GR. 10% SOLUTION 1455
648469-5MG TROGLITAZONE 2274
648471-500MG TROLOX 920
648480-100UG TROPONIN I, HUMAN HEART 6703
648484-100UG TROPONIN T, HUMAN HEART 5014
650200-100MG TRYPSIN, BOV. PANCREAS, HIGH PURITY 1598
650200-300MG TRYPSIN, BOV. PANCREAS, HIGH PURITY 3243
650211-100UG TRYPSIN, EXCISION GRADE, BOVINE PANCREAS 1187
650212-1KIT PROTEOEXTRACT ALL-IN-1 TRYPSIN DIGEST KT 4615
6502-2.5MU TRYPSIN, BOVINE PANCREAS 870
6502-25MU TRYPSIN, BOVINE PANCREAS 5927
650275-50UG TRYPSIN, IODINATION GR., HU. PANCREAS 3000
650277-1SET TRYPSIN, BOVINE, MS GRADE 2011
650279-1SET TRYPSIN, PORCINE, MS GRADE 1806
650297-1ML ANTI-TRYPSIN RABBIT PAB 4724
650345-1MG TRYPSIN INHIBITOR, CORN 4028
65035-100MG TRYPSIN INHIBITOR, SOYBEAN 1053
65035-1GM TRYPSIN INHIBITOR, SOYBEAN 5265
650357-100MG TRYPSIN INHIBITOR, SOYBEAN 1304
650357-250MG TRYPSIN INHIBITOR, SOYBEAN 2842
650366-25UG TRYPTASE, HUMAN LUNG 5365
650367-500UG ANTI-TRYPTASE RABBIT PAB 4739
651070-500UG TUBULYSIN A, MYXOBACTERIA SP. 3543
6540-100GM L-TRYPTOPHAN 1471
654085-10MG TTNPB 3350
654160-5MG TUBULIN POLYMERIZATION INHIBITOR 1605
654161-50UG TUBULIN-ALPHA-1, HIS*TAG FUSION 2407
654163-50UG TUBULIN-GAMMA-1, HIS*TAG FUSION 2407
654164-5MG TUBULIN POLYMERIZATION INHIBITOR II 1605
654205-10UG TUMOR NECROSIS FACTOR-A, HUMAN, RECOMB. 5248
654245-10UG TUMOR NECROSIS FACTOR-A, MOUSE, RECOMB. 4814
654250-1MG ANTI-TUMOR NECROSIS FACTOR-A RABBIT PAB 4958
654255-1MG TUMOR NECROSIS FACTOR-A ANTAGONIST 3427
654256-5MG TNF-ALPHA INHIBITOR 3427
654257-10MG TNF-ALPHA ANTAGONIST III, R-7050 2090
654300-1ML ANTI-TUMOR NECROSIS FACTOR-A RABBIT PAB 5046
654380-10MG TUNICAMYCIN, STREPTOMYCES LYSOSUPERFICUS 2040
654380-50MG TUNICAMYCIN, STREPTOMYCES LYSOSUPERFICUS 5950
655200-10MG TX-1123 1689
655203-10MG TX-1918 1689
655204-100ML TWEEN 20 DETERGENT, MB GRADE 569
655205-250ML TWEEN 20 DETERGENT 753
655206-50ML TWEEN 20, PROTEIN GR. DETERGENT, 10% SOL 1187
655207-50ML TWEEN 80, PROTEIN GR. DETERGENT, 10% SOL 1187
656000-100UL PD ANTI-TYK2 (PTYR1054/1055) RABBIT PAB 5512
6570-100GM L-TYROSINE, FREE BASE 803
657012-100UL ANTI-TYROSINE HYDROXYLASE RABBIT PAB 4636
657021-1SET TYROSINE KINASE INHIBITOR SET II 5081
658390-5MG AG 9 803
658395-5MG AG 18 970
658400-5MG AG 82 970
658401-5MG AG 490 644
658403-5MG AG 538 1254
658408-10MG AG 490, M-CF3 1638
658411-5MG INSOLUTION AG490 826
658425-5MG AG 17 970
658452-5MG AG 126 1806
658460-5MG AG 879 1689
658520-5MG AG 1387 1605
658548-1MG INSOLUTION(TM) AG 1478 1168
658550-5MG AG 1295 1605
658551-5MG AG 1296 1872
658552-5MG AG 1478 1973
658553-5MG AG 1433 2056
662005-10MG U0126 3980
662005-1MG U0126 1039
662005-20MG U0126 6643
662005-5MG U0126 2649
662006-1MG U0124 1304
662015-10MG U18666A 1689
662035-5MG U-73122 1822
662036-500UG PRO-SUMO-1, HUMAN, RECOMBINANT 4291
662037-500UG SUMO-1, HUMAN, RECOMBINAT, E. COLI 3448
662038-500UG PRO-SUMO-2, HUMAN, RECOMBINANT 4291
662039-500UG SUMO-2, HUMAN, RECOMBINANT, E COLI 4291
662040-500UG PRO-SUMO-3, HUMAN, RECOMBINANT 4291
662041-5MG U-73343 1822
662042-500UG SUMO-3, HUMAN, RECOMBINANT, E COLI 4291
662045-100UL ANTI-UCP-1 (145-159) RABBIT PAB 4914
662047-100UL ANTI-UCP-2 (144-157) RABBIT PAB 4914
662048-100UL ANTI-UCP-3 (147-159) RABBIT PAB 4841
662051-50UG UBCH2, HUMAN, RECOMBINANT 5753
662053-50UG UBCH3, HUMAN, RECOMBINANT 3794
662056-50UG UBIQUITIN ALDEHYDE 3661
662057-1MG UBIQUITIN, GST-FUSION, RECOM 3761
662060-1MG UBIQUITIN, HIS*TAG, RECOMBINANT, E. COLI 3009
662060-2MG UBIQUITIN, HIS*TAG, RECOMBINANT, E. COLI 2250
662065-1MG METHYLATED UBIQUITIN, HUMAN, RECOMBINANT 1822
662066-10UG GANKYRIN, HIS-TAG, HUMAN, RECOMBINANT 4864
662067-10UG PYK2, HIS-TAG, HUMAN, RECOMBINANT 4864
662068-10UG AXL, GST-FUSION, HUMAN, REC. 4864
662069-5UG P38GAMMA, HIS-TAG, HUMAN, RECOMBINANT 4864
662070-10UG UBIQUITIN-ACTIVATING ENZYME E1, RABBIT 4714
662072-25UG UBIQUITIN-ACTIVATING ENZYME E1, HUMAN 4263
662073-50UG SUMO-ACTIVATING ENZYME E1,GST-FUSION 4948
662075-25UG UBIQUITIN-AMC 6251
662076-25UG ISG15-ACTIVATING ENZYME E1, HUMAN 4948
662077-100UG FAT10, HIS*TAG, HUMAN, REC., E. COLI 2875
662082-100UG UBCH8 CONJUGATING ENZYME, HU., RECOM 4714
662083-100UG UBCH9 CONJUGATING ENZYME, HU., RECOM, 4714
662084-10MG USP7 Inhibitor, HBX 41,108  1149
662086-10MG UCH-L1 INHIBITOR 1739
662087-25UG UCH-L1, HIS TAG, MOUSE, RECOMBINANT 3794
662088-10MG UCH-L1 INHIBITOR II 1309
662089-10MG UCH-L3 INHIBITOR 1739
662090-10UG UBIQUITIN C-TERMINAL HYDROLASE, RABBIT 3761
662091-50UG UBIQUITIN CONJUGATING ENZYME 5A, RECOM 3995
662092-50UG UBIQUITIN CONJUGATING ENZYME 5B, RECOM 3995
662094-50UG UBIQUITIN CONJUGATING ENZYME 6, RECOM 3995
662095-50UG UBIQUITIN CONJUGATING ENZYME 10, RECOM 3995
662096-1KIT UBIQUITIN PROTEIN CONJUGATION KIT 8023
662098-50UG UBCH5C, HUMAN, RECOMBINANT 5119
662099-50UL ANTI-UBIQUITIN RABBIT PAB 4113
662103-100UG UBCH13, HIS TAG, HUMAN, RECOMBINANT 5119
662105-25MG UBIQUITIN E1 INHIBITOR, PYR-41 3413
662106-200UL ANTI-UBIQUITIN-ACT ENZYME E1A/E1B RB PAB 4037
662116-1SET UBIQUITIN CONJUGATING ENZYME SET 9544
662118-100UG ANTI-UBIQUITIN CONJUG ENZYME E2 N RB PAB 4695
662125-10MG UBIQUITIN ISOPEPTIDASE INHIBITOR I, G5 3112
662126-10MG UBIQUITIN ISOPEPTIDASE INHIBITOR II, F6 5901
662127-10UG KIT, HIS-TAG, HUMAN, RECOMBINANT 4864
662130-10UG JAK2, HIS-TAG, HUMAN, RECOMBINANT 4764
662135-5UG PIM2, GST-FUSION, HUMAN, REC. 4864
662136-5UG STK3, GST-FUSION, HUMAN, REC. 4864
662137-5UG BRK, GST-FUSION, HUMAN, REC. 4864
662200-1KIT UBIQUITINATED PROTEIN ENRICHMENT KIT 6215
663001-150UG IRS1-P30, HUMAN, REC., E. COLI 9661
6630-10GM URACIL 485
66612-1KG UREA 1087
666122-2.5KG UREA, MB GRADE 2274
666122-500GM UREA, MB GRADE 753
666133-10KU UREASE, CANAVALIA ENSIFORMIS 702
6680-100GM URIDINE 3677
6680-25GM URIDINE 1187
670105-5MG UDP-A-D-N-ACETYLGALACTOSAMINE, DISODIUM 2357
670107-50MG UDP-A-D-N-ACETYLGLUCOSAMINE, DISODIUM 1120
670111-10MG UDP-A-D-GALACTOSE, DISODIUM SALT 619
670111-50MG UDP-A-D-GALACTOSE, DISODIUM SALT 1455
670112-1MG UDP-GALACTOSE 4-EPIMERASE, RECOM 1889
670120-250MG UDP-A-D-GLUCOSE, DISODIUM SALT 1371
670121-10U UDP-GLUCOSE DEHYDROGENASE, RECOM 6753
670121-2U UDP-GLUCOSE DEHYDROGENASE, RECOM 1889
6701-50MG URIDINE-5'-TRIPHOSPHATE, TRISODIUM SALT 569
672081-3000IU UROKINASE, HMW, HUMAN URINE 2649
672112-10KU UROKINASE, HUMAN URINE 3168
672152-5MG UPA INHIBITOR II, UK122 2469
672157-5MG UROKINASE SUBSTRATE I, COLORIMETRIC 1283
672159-25MG UROKINASE SUBSTRATE III, FLUOROGENIC 970
672315-50MG Ursolic Acid  590
673000-10MG VACUOLIN-1 1689
676377-100MG VALINOMYCIN, STREPTOMYCES FULVISSIMUS 4329
676377-25MG VALINOMYCIN, STREPTOMYCES FULVISSIMUS 1254
676380-5GM VALPROIC ACID, SODIUM SALT 903
676386-100UG ANTI-VIPR1 MOUSE MAB (AS58) 4695
676390-10MG V2R ANTAGONIST, V2RINH-02 1505
676472-10UG VEGF165, HU., RECOM 6285
676473-5UG VEGF121, HU., RECOM 4430
676474-5UG VEGF164, MOUSE, RECOM 3761
676476-20UG VEGF-C, RAT, RECOM 10020
676480-1MG VEGF RECEPTOR 2 KINASE INHIBITOR I 1839
676481-5MG VEGFR TYROSINE KINASE INHIBITOR II 2390
676483-500UG VEGF RECEPTOR TYROSINE KINASE INHIBITOR 2240
676484-5MG VEGF RECEPTOR 2 KINASE INHIBITOR VI 3092
676485-1MG VEGF RECEPTOR 2 KINASE INHIBITOR II 1839
676486-50UG ANTI-VEGF RECEPTOR 2 MOUSE MAB (CH-11) 3671
676487-1MG VEGFR2 KINASE INHIBITOR III (SU5416) 2123
676488-50UL ANTI-VEGF RECEPTOR 2 RABBIT PAB 2896
676489-1MG VEGF RECEPTOR 2 KINASE INHIBITOR IV 1354
676490-50UG VEGF RECEPTOR 2(D1-7) HUMAN, RECOMBINANT 7171
676491-10MG VEGF INDUCER, GS4012 1739
676492-10MG VEGF RECEPTOR 3 KINASE INHIBITOR, MAZ51 1739
676493-1MG VEGF INHIBITOR, FLT2-11 2407
676494-1MG VEGF INHIBITOR, JE-11 4931
676495-1MG VEGF INHIBITOR, V1 1906
676496-1MG VEGF INHIBITOR, CBO-P11 4196
676498-500UG INSOLUTION VEGR2 KINASE INHIBITOR III 1506
676500-5MG VEGFR-2/FLT3/C-KIT INHIBITOR 2925
676501-5MG VEGFR TYROSINE KINASE INHIBITOR V 2965
676502-1EA InhibitorSelect™ VEGF Signaling Pathway Inhibitor Panel  12429
676602-100UG PD ANTI-VASP (PSER239) MOUSE MAB (16C2) 4900
676604-100UG PD ANTI-VASP (PSER157) MOUSE MAB (5C6) 8809
676700-1SET ANTI-VASP RABBIT PAB 4417
676777-100MG (+/-)-VERAPAMIL, HCL 803
676925-5MG VERATRAMINE, HCL, V. CALIFORNICUM 2959
676950-5MG VERATRIDINE 1137
677175-10MG VINBLASTIN SULFATE 1705
677181-10MG VINCRISTINE SULFATE, APOCYNACEAE SP. 5048
679100-1MG VITAMIN D2, 1A-HYDROXY- 2223
679101-50UG VITAMIN D3, 1A, 25-DIHYDROXY- 4229
679102-1MG VITAMIN D3, 25-HYDROXY- 1705
679104-1MG VITAMIN D3, 1A-HYDROXY- 2858
679130-100MG VITAMIN E SUCCINATE 652
6791-5GM VITAMIN B12 3276
681105-100UG VITRONECTIN, HUMAN PLASMA 6235
681125-1ML ANTI-VITRONECTIN RABBIT PAB 4300
681300-100UG VON WILLEBRAND FACTOR, HUMAN PLASMA 5767
681500-1MG WHI-P180, HYDROCHLORIDE 2357
681500-500UG WHI-P180, HYDROCHLORIDE 1471
681505-1ST ANTI-CAV2.2 RABBIT PAB 2383
681507-1ST ANTI-CAV1.2 RABBIT PAB 2250
681509-1ST ANTI-CAV1.3 RABBIT PAB 2383
681525-1MG WISKOSTATIN 1605
681525-5MG WISKOSTATIN 5583
681535-1MG WITHAFERIN A, WITHANIA SOMNIFERA 1521
681535-5MG WITHAFERIN A, WITHANIA SOMNIFERA 4897
681625-1MG W-5, HCL 1438
681629-10MG W-7, HCL 1488
681635-1MG W-12, HCL 1438
681636-1MG W-13, HCL 1438
681637-1MG WEE1/CHK1 INHIBITOR *PD0407824* 2140
681640-1MG WEE1 INHIBITOR 2140
681641-1MG WEE1 INHIBITOR II 2507
681660-1MG N-WASP INHIBITOR, 187-1 4630
681665-5MG WNT AGONIST 2775
681666-1EA INHIBITORSELECT WNT SIGNALING PATHWAY IN 18954
681668-5MG WNT SYNERGIST, QS11 3987
681669-10MG WNT ANTAGONIST I, IWR-1-ENDO 1718
681670-10MG WOGONIN, S. BAICALENSIS 2975
681671-10MG WNT ANTAGONIST II, IWP-2 2469
681673-10MG Wnt Antagonist III, Box5  1588
681675-1MG WORTMANNIN 1371
681676-1MG INSOLUTION WORTMANNIN 1525
681725-50MG WY-14643 1872
681816-5MG LECTIN, WHEAT GERM, TRITICUM VULGARIS 953
681817-1SET LECTIN, WHEAT GERM, AGAROSE CONJUGATE 4089
6820-5GM XANTHINE 870
682151-10U XANTHINE OXIDASE, BUTTERMILK 819
682151-50U XANTHINE OXIDASE, BUTTERMILK 2892
682160-10UG XESTOSPONGIN C, XESTOSPONGIA SP. 3243
682162-50UG XESTOSPONGIN D, XESTOSPONGIA SP. 6552
684274-500MIU B1,2-XYLOSIDASE, XANTHOMONAS SP. 4697
684500-25MG ZAPRINAST 920
688000-10MG Y-27632 15405
688000-1MG Y-27632 2150
688000-5MG Y-27632 9544
688001-500UG INSOLUTION(TM) Y-27632 1416
688100-5MG YC-1 2106
688150-10UG YES, HIS TAG, RECOMBINANT 6335
688225-5MG CASPASE-1 SUBSTRATE VI, FLUOROGENIC 5299
69001-3 FIRST STRAND CDNA SYNTHESIS KIT 3796
69002-3 PERFECT DNA MKR, 0.5-12 KBP 1533
69003-3 PERFECT RNA MKR TEMPLATE MIX 1917
69009-3 NOVABLUE GLYCEROL STOCK 1732
69015-3 PET-32A(+) DNA 3754
69016-3 PET-32B(+) DNA 3754
69017-3 PET-32C(+) DNA 3754
69022-3 THROMBIN CLEAVAGE CAPTURE KIT 3987
69025-3 T7*TAG PURIFICATION KIT 4170
69026-3 T7*TAG ANTIBODY AGAROSE 5538
69036-3 FACTOR XA 1502
69037-3 FACTOR XA CLEAVAGE CAPTURE KIT 3653
69038-3 XARREST AGAROSE 2202
69041-3 B834(DE3) COMP CELLS 1756
69041-4 B834(DE3) COMP CELLS 3249
69042-3 B834(DE3)PLYSS CC 1814
69042-4 B834(DE3)PLYSS CC 3346
69046-3 6X DNA GEL LOADING BUFFER 650
69047-3 S-PROTEIN HRP CONJUGATE 2019
69048-3 T7*TAG HRP CONJUGATE 3971
69049-3 PELLET PAINT CO-PRECIPITANT 1267
69049-4 PELLET PAINT CO-PRECIPITANT 8107
69050-3 ANTI-CRE ANTIBODY 2152
69051-3 XA CLEAVAGE CONTROL PROTEIN 751
69053-3 BLR(DE3) COMP CELLS 1756
69053-4 BLR(DE3) COMP CELLS 3249
69058-3 S*TAG HRP LUMIBLOT KIT 4211
69059-3 SUPERSIGNAL SUBSTRATE 1420
69060-3 S-PROTEIN FITC CONJUGATE 4825
69065-3 S*TAG REK PURIFICATION KIT 5054
69066-3 RECOMBINANT ENTEROKINASE 1850
69067-3 ENTEROKINASE CLEAVAGE CAPTURE 3386
69068-3 EKAPTURE AGAROSE 1101
69068-4 EKAPTURE AGAROSE 5789
69069-3 CLEAVAGE CONTROL PROTEIN 751
69072-3 SPIN FILTER, 2ML 280
69074-3 SPIN FILTER, 5ML 367
69076-3 PET-32 EK/LIC VECTOR KIT 7713
69077-3 PET-30 EK/LIC VECTOR KIT 7506
69078-3 PERFECT PROTEIN HRP WESTERN 2135
69079-3 PERFECT PROTEIN MKR, 10-225KDA 1502
69080-3 PT7BLUE-2 T-VECTOR 1957
69086-3 CDP-STAR SUBSTRATE 2713
69099-3 S*TAG AP LUMIBLOT KIT 4303
69101-3 CARBENICILLIN 3675
69102-3 GLOCATOR LUMINESCENT LABELS 501
69103-3 IE1 PROMOTER PRIMER 1433
69137-3 DEVELOPMENT FOLDERS 566
691400-10MG ZEBULARINE 2257
691400-25MG ZEBULARINE 4797
69142-3 BLT5403 GLYCEROL STOCK 2038
69149-3 PERFECT PROTEIN MKR, 15-150KDA 1502
691550-25MG ZINC (II) PROTOPORPHYRIN IX 987
69164-3 DNASE I, DS QUALIFIED 1101
691700-100UG ANTI-ZIP KINASE (279-298) RABBIT PAB 4271
69171-3 HSV*TAG MONOCLONAL AB 2335
69171-4 HSV*TAG MONOCLONAL AB 9109
69180-3 6X LOADING BUFFER 634
69182-3 DNASE I, RNASE-FREE 1101
692000-1MG ZM 336372 2457
69203-3 STREPTAVIDIN AGAROSE 3848
69209-3 BLR(DE3)PLYSS GLYCEROL STOCK 1732
69211-3 RNA MARKERS, 0.36 - 9.5 KB 1732
69212-3 S*TAG RAPID ASSAY KIT 2102
69213-3 S*TAG AP WESTERN BLOT KIT 3837
69214-3 PET UPSTREAM PRIMER 1401
69215-3 S*TAG GRADE S-PROTEIN 3887
69217-3 S*TAG STANDARD 4637
69218-3 BIOTINYLATED S-PROTEIN 3510
69219-3 STREPTAVIDIN AP CONJUGATE 1852
69230-3 PIG GENOMIC DNA 2049
69231-3 BOVINE GENOMIC DNA 2049
69232-3 S*TAG THROMBIN PURIFICATION KIT 5054
69233-3 CHICKEN GENOMIC DNA 2049
69234-3 DOG GENOMIC DNA 2049
69235-3 CAT GENOMIC DNA 4158
69237-3 HUMAN GENOMIC DNA 2049
69238-3 RAT GENOMIC DNA 2049
69239-3 MOUSE GENOMIC DNA 2049
69240-3 S. CEREVISIAE GENOMIC DNA 1985
69247-3 CRE RECOMBINASE 1666
69248-3 T4 POLYNUCLEOTIDE KINASE 2324
69264-3 AP DETECTION REAGENT KIT 1962
69264-4 AP DETECTION REAGENT KIT 4998
69265-3 GOAT ANTI-RABBIT AP CONJUGATE 1018
69266-3 GOAT ANTI-MOUSE IGG AP CONJUGATE 959
69278-3 PCR MARKERS 1485
69280-3 NOVATOPE LIBRARY CONSTRUCTION SYSTEM 14296
69281-3 DNASE SHOTGUN CLEAVAGE KIT 4287
69282-3 SINGLE DA TAILING KIT 4287
69284-3 NOVABLUE(DE3) COMP CELLS 1756
69284-4 NOVABLUE(DE3) COMP CELLS 3249
69287-3 B834 GLYCEROL STOCK 2096
693015-25GM ZWITTERGENT 3-12 DETERGENT 5432
693015-5GM ZWITTERGENT 3-12 DETERGENT 1455
693017-100GM ZWITTERGENT 3-14 DETERGENT 19505
693017-25GM ZWITTERGENT 3-14 DETERGENT 5432
693017-5GM ZWITTERGENT 3-14 DETERGENT 1438
693019-5GM ZWITTERGENT 3-08 DETERGENT 1471
693021-100GM ZWITTERGENT 3-10 DETERGENT 17516
693021-25GM ZWITTERGENT 3-10 DETERGENT 5432
693021-5GM ZWITTERGENT 3-10 DETERGENT 1471
693023-25GM ZWITTERGENT 3-16 DETERGENT 5432
693023-5GM ZWITTERGENT 3-16 DETERGENT 1471
693030-1KIT ZWITTERGENT TEST KIT 2123
69337-3 T7 TERMINATOR PRIMER 1401
69341-3 T7 GENE 10 PRIMER 1401
69348-3 T7 PROMOTER PRIMER 1401
693520-1L WATER, DEPC-TREATED, MOLECULAR BIOLOGY G 870
69386-3 BL21 GLYCEROL STOCK 2038
69387-3 BL21(DE3) GLYCEROL STOCK 2038
69388-3 BL21(DE3)PLYSS GLYCEROL STOCK 2038
69389-3 BL21(DE3)PLYSE GLYCEROL STOCK 2038
69390-3 BACTERIOPHAGE CE6 1917
69390-4 BACTERIOPHAGE CE6 7569
69405-3 PET SYSTEM 11 8225
69406-3 PET SYSTEM 11 + CC 10058
69409-3 PET SYSTEM 3 8225
69410-3 PET SYSTEM 3 + CC 10058
69415-3 PET SYSTEM 9 8225
69416-3 PET SYSTEM 9 + CC 10058
69418-3 PET-3A DNA 2641
69419-3 PET 3B DNA 2641
69420-3 PET-3C DNA 2641
69421-3 PET-3D DNA 2641
69431-3 PET-9A DNA 2641
69432-3 PET 9B DNA 2641
69433-3 PET-9C DNA 2641
69434-3 PET-9D DNA 2641
69436-3 PET-11A DNA 2641
69437-3 PET-11B DNA 2641
69438-3 PET-11C DNA 2641
69439-3 PET-11D DNA 2641
69449-3 BL21 COMP CELLS 1756
69449-4 BL21 COMP CELLS 3249
69450-3 BL21(DE3) COMP CELLS 1756
69450-4 BL21(DE3) COMP CELLS 3249
69451-3 BL21(DE3)PLYSS CC 1756
69451-4 BL21(DE3)PLYSS CC 3249
69452-3 HMS174 COMP CELLS 1756
69452-4 HMS174 COMP CELLS 3249
69453-3 HMS174(DE3) CC 1756
69453-4 HMS174(DE3) CC 3249
69454-3 HMS174(DE3)PLYSS CC 1756
69454-4 HMS174(DE3)PLYSS CC 3249
69522-3 T7*TAG MONOCLONAL ANTIBODY 3002
69522-4 T7*TAG MONOCLONAL ANTIBODY 11376
69593-3 MAGNETIGHT OLIGO(DT) PARTICLES 5943
69598-3 S-PROTEIN AP CONJUGATE 2135
69658-3 PLYSE DNA 1614
69659-3 PLYSS DNA 1614
69660-3 PET-14B DNA 3351
69661-3 PET-15B DNA 3351
69662-3 PET 16B DNA 3351
69663-3 PET-17B DNA 3351
69670-3 HIS*BIND RESIN 1445
69670-4 HIS*BIND RESIN 5722
69670-5 HIS*BIND RESIN 10495
69671-3 THROMBIN, RESTRICTION GRADE 1502
69672-3 BIOTINYLATED THROMBIN 3303
69673-3 CHROMATOGRAPHY COLUMNS 465
69677-3 PET-19B DNA 3351
69704-3 S-PROTEIN AGAROSE 1485
69704-4 S-PROTEIN AGAROSE 5789
69723-3 SLIDE CHAMBERS 495
69725-3 LAMBDA DE3 LYSOG. KIT + PLYSS & PLYSE 5538
69726-3 PET SYSTEM 17B 4137
69731-3 PET SYSTEM 17B + CC 5874
69734-3 LAMBDA DE3 LYSOGENIZATION KIT 4561
69739-3 PET-20B(+) DNA 3351
69740-3 PET-21A(+) DNA 3351
69741-3 PET 21B(+) DNA 3351
69742-3 PET-21C(+) DNA 3351
69743-3 PET-21D(+) DNA 3351
69744-3 PET-22B(+) DNA 3351
69745-3 PET-23A(+) DNA 3351
69746-3 PET-23B(+) DNA 3351
69747-3 PET-23C(+) DNA 3351
69748-3 PET-23D(+) DNA 3351
69749-3 PET-24A(+) DNA 3351
69750-3 PET-24B(+) DNA 3351
69751-3 PET-24C(+) DNA 3351
69752-3 PET-24D(+) DNA 3351
69753-3 PET-25B(+) DNA 3351
69755-3 HIS*BIND BUFFER KIT 2019
69770-3 PET-21(+) DNA 3351
69771-3 PET 23(+) DNA 3351
69772-3 PET-24(+) DNA 3351
69819-3 U-19MER PRIMER 1401
69820-3 PT7BLUE T-VECTOR 2536
69825-3 NOVABLUE COMP CELLS 1756
69825-4 NOVABLUE COMP CELLS 3249
69830-3 HUMAN IG-PRIMER SET 9662
69831-3 MOUSE IG-PRIMER SET 11326
69838-3 DNA LIGATION KIT 2319
69839-3 T4 DNA LIGASE 883
69839-4 T4 DNA LIGASE 3153
69862-3 PET-26B(+) DNA 3351
69863-3 PET-27B(+) DNA 3351
69864-3 PET-28A(+) DNA 3351
69865-3 PET-28B(+) DNA 3351
69866-3 PET-28C(+) DNA 3351
69871-3 PET-29A(+) DNA 6671
69872-3 PET-29B(+) DNA 6671
69873-3 PET-29C(+) DNA 6092
69896-3 OLIGO(DT) PRIMER 934
69905-3 BLT5615 GLYCEROL STOCK 2038
69909-3 PET-30A(+) DNA 3351
69910-3 PET-30B(+) DNA 3351
69911-3 PET-30C(+) DNA 3351
69916-3 PSCREEN T-VECTOR 2536
69917-3 PSCREEN T-VECTOR KIT 4415
69924-3 PERFECT RNA MKRS, 0.1-1 KB 1684
69945-3 S*TAG PRIMER 1401
69946-3 PERFECT RNA MKRS, 0.2-10 KB 1684
69952-3 PET-31B(+) DNA 3754
69954-3 PET-31B(+) DNA, ALWN I DIGEST 5308
69956-3 BLR(DE3)PLYSS CC 1756
69956-4 BLR(DE3)PLYSS CC 3249
69959-3 PERFECT PROTEIN WSTRN MKRS 718
69960-3 STRAIGHT A'S LYSIS BUFFER 883
69961-3 STRAIGHT A'S WASH BUFFER 2008
69962-3 STRAIGHT A'S SYS + STAND 12124
69963-3 STRAIGHT A'S SYSTEM 6472
69964-3 MAGNETIGHT SEP. STAND 2236
69965-3 PERFECT PROTEIN AP WESTERN 2135
69967-3 PT7BLUE DNA 3103
69968-3 BIOTINYLATED T7*TAG AB 3153
69974-3 PSCREEN-1B(+) DNA 3754
69992-3 ORIENTEXPRESS CDNA SYNTHESIS KIT, RP 9628
69993-3 ORIENTEXP. CDNA SYNTHESIS KIT, OLIGO(DT) 9628
69994-3 ECOR I/HIND III END MODIFICATION KIT 2424
69995-3 MINI COLUMN FRACTIONATION KIT 1585
69999-3 T7*TAG ANTIBODY AP CONJUGATE 3687
70003-3 PBAC-1 DNA 3019
70004-3 PBAC-2CP DNA 3019
70005-3 T7SELECTUP PRIMER 1401
70006-3 T7SELECTDOWN PRIMER 1401
70010-3 T7SELECT1-1 CLONING KIT 16007
70014-3 T7SELECT PACKAGING KIT 7589
70015-3 T7SELECT415-1 CLONING KIT 16007
70018-3 T7SELECT BIOPANNING KIT 6964
70021-3 PBAC-2CP E. COLI EK/LIC VECTOR KIT 7209
70025-3 PT7BLUE-3 DNA 3103
70030-3 BACVECTOR-2000 TRANSFECTION KIT 10375
70034-3 BACPLAQUE AGAROSE 3352
70036-3 X-GLUC SOLUTION 1317
70040-3 T7SELECT415-1B DNA 4461
70042-3 T7SELECT1-2A DNA 4461
70043-3 T7SELECT1-2B DNA 4461
70044-3 T7SELECT1-2C DNA 4461
70045-3 PBAC4X-1 DNA 3019
70048-3 T7SELECT1-1B DNA 4461
70049-3 PBACGUS-2CP DNA 2892
70051-3 PBACGUS-2CP E. COLI EK/LIC VECTOR KIT 7206
70054-3 PBACGUS-1 DNA 2892
70055-3 PBACSURF-1 DNA 2892
70057-3 BACVECTOR-1000 DNA KIT 5748
70058-3 BACVECTOR-2000 DNA KIT 5588
70059-3 BACVECTOR-1000 TRANSFECTION KIT 10375
70060-3 PBACGUS4X-1 DNA 2892
70072-3 PET-32 XA/LIC VECTOR KIT 7506
70073-3 PET-30 XA/LIC VECTOR KIT 7506
70075-3 INTRO PT7BLUE-3 BLUNT KIT 2319
70077-3 BACVECTOR-3000 TRANSFECTION KIT 10375
70078-3 BACVECTOR-3000 DNA KIT 5588
70087-3 PERFECT DNA MKRS, 0.1-12 KBP 1533
70088-3 PBAC-3 DNA 3019
70089-3 PBACGUS-3 DNA 2892
70090-3 PET-39B(+) DNA 3754
70091-3 PET-40B(+) DNA 3754
70099-3 T4 DNA POLYMERASE, LIC-QUAL. 4304
70123-3 PROTEIN REFOLDING KIT 1869
70147-3 VACUUM MANIFOLD 11131
70171-3 PIE1-NEO DNA 3019
70174-3 PT7BLUE BLUNT VECTOR 2069
70174-4 PT7BLUE BLUNT VECTOR 3520
70179-4 END CONVERSION MIX 10526
70181-3 NOVABLUE SINGLES 1902
70181-4 NOVABLUE SINGLES 3553
70182-3 PT7BLUE-3 BLUNT KIT 4287
70182-4 PT7BLUE-3 BLUNT KIT 7090
70183-3 INTRO. PT7BLUE BLUNT KIT 2319
70184-3 INTRO. PSTBLUE-1 BLUNT KIT 2319
70186-3 PT7BLUE-2 BLUNT VECTOR 2069
70186-4 PT7BLUE-2 BLUNT VECTOR 3520
70187-3 PT7BLUE-3 BLUNT VECTOR 2069
70187-4 PT7BLUE-3 BLUNT VECTOR 3520
70188-3 PSTBLUE-1 BLUNT VECTOR 2069
70188-4 PSTBLUE-1 BLUNT VECTOR 3520
70189-3 PT7BLUE BLUNT KIT 4287
70189-4 PT7BLUE BLUNT KIT 7090
70191-3 PSTBLUE-1 BLUNT KIT 4287
70191-4 PSTBLUE-1 BLUNT KIT 7090
70199-3 PSTBLUE-1 DNA 3754
70200-3 T7SELECT1-1 ORIENTEXP.CDNACLON.SYST.(DT) 25281
70202-3 T7SELECT1-1 ORIENTEXP.CDNA CLON.SYST.RP 25291
70222-3 PBAC-5 DNA 3019
70223-3 PBACGUS-5 DNA 3019
70224-3 PBAC-6 DNA 3019
70225-3 PBACGUS-6 DNA 2892
70232-3 BL21 COMPETENT CELL SET 3552
70234-3 HMS174 COMPETENT CELL SET 3649
70235-3 BL21(DE3) SINGLES 1902
70235-4 BL21(DE3) SINGLES 3553
70236-3 BL21(DE3)PLYSS SINGLES 1902
70236-4 BL21(DE3)PLYSS SINGLES 3553
70237-3 T7*TAG AP LUMIBLOT KIT 25572
70238-3 T7*TAG HRP LUMIBLOT KIT 6639
70239-3 HIS*BIND PURIFICATION KIT 2948
70526-3 CLONABLES KIT 2319
70527-3 100 MM IPTG SOLUTION 1317
70532-3 GST*TAG ASSAY KIT 2102
70534-3 GST*BIND BUFFER KIT 1869
70537-3 PERFECT DNA 1 KB LADDER 1485
70538-3 PERFECT DNA 50 BP LADDER 1565
70539-3 PERFECT DNA 100 BP LADDER 1485
70540-3 PERFECT DNA MKR, .05-10 KBP 2276
70541-3 GST*BIND RESIN 2890
70541-4 GST*BIND RESIN 9940
70541-5 GST*BIND RESIN 5853
70548-3 T7SELECT10-3B DNA 4461
70550-3 T7SELECT10-3 CLONING KIT 16007
70554-3 STREPTAVIDIN AP LUMIBLOT KIT 5334
70556-3 PET-41A(+) DNA 3754
70557-3 PET-41B(+) DNA 3754
70558-3 PET-41C(+) DNA 3754
70559-3 PET SYSTEM 41 8578
70560-3 PET SYSTEM 41+CC 10334
70561-3 PET-42A(+) DNA 3754
70562-3 PET-42B(+) DNA 3754
70563-3 PET-42C(+) DNA 3754
70564-3 PET SYSTEM 42 8578
70565-3 PET SYSTEM 42+CC 10334
70566-3 T7 RNA POLYMERASE MONOCLONAL ANTIBODY 2319
70566-4 T7 RNA POLYMERASE MONOCLONAL ANTIBODY 9109
70572-3 HUMAN MALE GENOMIC DNA 1985
70573-3 CLONABLES 2X LIGATION PREMIX 634
70573-4 CLONABLES 2X LIGATION PREMIX 10526
70580-3 T7SELECT10-3 ORIENTEXP.CDNA CLON.SYST.RP 25291
70581-3 T7SELECT10-3 ORIENTEXP.CDNA CLON.SYST.DT 25291
70584-3 BUGBUSTER PROTEIN EXTRACTION REAGENT 1059
70584-4 BUGBUSTER PROTEIN EXTRACTION REAGENT 4203
70590-3 BACVECTOR INSECT CELL MEDIUM 1533
70594-3 INTRO PSTBLUE-1 ACCEPTOR VECTOR KIT 2319
70595-3 PSTBLUE-1 ACCEPTOR VECTOR KIT 4287
70595-4 PSTBLUE-1 ACCEPTOR VECTOR KIT 7090
70596-3 PSTBLUE-1 ACCEPTOR VECTOR 2069
70596-4 PSTBLUE-1 ACCEPTOR VECTOR 3520
70597-3 INTRO PETBLUE-1 ACCEPTOR VECTOR KIT 2536
70598-3 PETBLUE-1 ACCEPTOR VECTOR KIT 4754
70598-4 PETBLUE-1 ACCEPTOR VECTOR KIT 7807
70599-3 PETBLUE-1 ACCEPTOR VECTOR 2069
70599-4 PETBLUE-1 ACCEPTOR VECTOR 3520
70605-3 HUMAN FEMALE GENOMIC DNA 1985
70606-3 RNA SAMPLE BUFFER 634
70607-3 4X SDS SAMPLE BUFFER 467
70608-3 PETBLUE-1 DNA 3754
70609-3 PETBLUE-2 DNA 3754
70610-3 PLACI DNA 1614
70615-3 BL21(DE3)PLACI GLYCEROL STOCK 2038
70617-3 ORIGAMI(DE3) GLYCEROL STOCK 2038
70618-3 ORIGAMI(DE3)PLYSS GLYCEROL STOCK 2038
70620-3 PETBLUE-1 BLUNT VECTOR 2069
70620-4 PETBLUE-1 BLUNT VECTOR 3520
70621-3 PETBLUE-2 BLUNT VECTOR 2069
70621-4 PETBLUE-2 BLUNT VECTOR 3520
70622-3 TUNER COMP CELLS 1858
70622-4 TUNER COMP CELLS 3432
70623-3 TUNER(DE3) COMP CELLS 1858
70623-4 TUNER(DE3) COMP CELLS 3432
70624-3 TUNER(DE3)PLYSS COMP CELLS 1858
70624-4 TUNER(DE3)PLYSS COMP CELLS 3432
70625-3 TUNER(DE3)PLACI COMP CELLS 1858
70625-4 TUNER(DE3)PLACI COMP CELLS 3432
70633-3 INTRO PETBLUE-1 BLUNT CLONING KIT 2536
70634-3 PETBLUE-1 BLUNT CLONING KIT 4754
70634-4 PETBLUE-1 BLUNT CLONING KIT 7807
70635-3 INTRO PETBLUE-2 BLUNT CLONING KIT 2536
70636-3 PETBLUE-2 BLUNT CLONING KIT 4754
70636-4 PETBLUE-2 BLUNT CLONING KIT 7807
70637-3 T7SELECT HUMAN BRAIN CDNA LIBRARY 11929
70638-3 T7SELECT HUMAN BREAST CDNA LIBRARY 11929
70639-3 T7SELECT HUMAN COLON CDNA LIBRARY 11929
70640-3 T7SELECT HUMAN HEART CDNA LIBRARY 11929
70641-3 T7SELECT HUMAN LIVER CDNA LIBRARY 11929
70642-3 T7SELECT HUMAN STOMACH CDNA LIBRARY 11929
70643-3 T7SELECT HUMAN ALZH. BRAIN CDNA LIBRARY 11929
70644-3 T7SELECT HUMAN BREAST TUMOR CDNA LIBRARY 11929
70645-3 T7SELECT HUMAN COLON TUMOR CDNA LIBRARY 11929
70646-3 T7SELECT HUMAN LUNG CDNA LIBRARY 11929
70647-3 T7SELECT HUMAN LIVER TUMOR CDNA LIBRARY 11929
70648-3 T7SELECT HUMAN LUNG TUMOR CDNA LIBRARY 11929
70663-4 PROTEINASE K, LYOPHILIZED 1120
70663-5 PROTEINASE K, LYOPHILIZED 4379
70664-3 BENZONASE, PURITY > 99% 2057
70666-3 NI-NTA HIS*BIND RESIN 1863
70666-4 NI-NTA HIS*BIND RESIN 3869
70666-5 NI-NTA HIS*BIND RESIN 12716
70673-3 PETBLUE-1 SYSTEM 5421
70674-3 PETBLUE-2 SYSTEM 5421
70690-3 MAGPREP BLOOD GENOMIC DNA KIT 2192
70691-3 NI-NTA HIS*BIND SUPERFLOW RESIN 2240
70691-4 NI-NTA HIS*BIND SUPERFLOW RESIN 5083
70691-5 NI-NTA HIS*BIND SUPERFLOW RESIN 17227
70693-3 HIS BIND FRACTOGEL (M) 3587
70714-3 FRET ARUAA SUBSTRATE 1384
70714-4 FRET ARUAA SUBSTRATE 7640
70724-3 FRETWORKS S*TAG ASSAY KIT 2486
70724-4 FRETWORKS S*TAG ASSAY KIT 14329
70726-3 TUNER COMP CELL SET* 3795
70746-3 BENZONASE NUCLEASE, PURITY > 90% 1670
70746-4 BENZONASE NUCLEASE, PURITY > 90% 562
70748-3 PELLET PAINT NF CO-PRECIPITANT 1267
70748-4 PELLET PAINT NF CO-PRECIPITANT 8107
70750-3 BUGBUSTER PLUS BENZONASE 5884
70751-3 BUGBUSTER NI-NTA HIS*BIND PURIF. KIT 5617
70753-3 PET SYSTEM 14B 4137
70754-3 PET SYSTEM 14B + CC 5874
70755-3 PET SYSTEM 15B 4137
70756-3 PET SYSTEM 15B + CC 5874
70757-3 PET SYSTEM 16B 4137
70758-3 PET SYSTEM 16B + CC 5874
70759-3 PET SYSTEM 19B 4137
70760-3 PET SYSTEM 19B + CC 5874
70761-3 PET SYSTEM 20B 4137
70762-3 PET SYSTEM 20B + CC 5874
70763-3 PET SYSTEM 21 9769
70764-3 PET SYSTEM 21 + CC 11485
70765-3 PET SYSTEM 22B 4137
70766-3 PET SYSTEM 22B PLUS COMPETENT CELLS 5874
70767-3 PET SYSTEM 23 9769
70768-3 PET SYSTEM 23 + CC 11485
70769-3 PET SYSTEM 24 9769
70770-3 PET SYSTEM 24 + CC 11485
70771-3 PET SYSTEM 25B 4137
70772-3 PET SYSTEM 25B PLUS COMPETENT CELLS 5874
70773-3 PET SYSTEM 26B 4137
70774-3 PET SYSTEM 26B PLUS COMPETENT CELLS 5874
70775-3 PET SYSTEM 27B 4137
70776-3 PET SYSTEM 27B PLUS COMPETENT CELLS 5874
70777-3 PET SYSTEM 28 7892
70778-3 PET SYSTEM 28 + CC 9628
70779-3 PET SYSTEM 29 8354
70780-3 PET SYSTEM 29 + CC 9904
70781-3 PET SYSTEM 30 7892
70782-3 PET SYSTEM 30 + CC 9628
70783-3 PET SYSTEM 31B 5187
70784-3 PET SYSTEM 31B + CC 6823
70785-3 PET SYSTEM 32 10476
70786-3 PET SYSTEM 32 + CC 12211
70789-3 PET SYSTEM 39B 5187
70790-3 PET SYSTEM 39B + CC 6823
70791-3 PET SYSTEM 40B 5187
70792-3 PET SYSTEM 40B + CC 6823
70793-3 BUGBUSTER HIS*BIND PURIFICATION KIT 6801
70794-3 BUGBUSTER GST*BIND PURIFICATION KIT 7884
70796-3 HIS*TAG MONOCLONAL ANTIBODY 13908
70796-4 HIS*TAG MONOCLONAL ANTIBODY 928
70814-3 FASTPLAX ANTIBODY 1101
70823-3 PTRIEX-3 DNA 4370
70824-3 PTRIEX-4 DNA 4370
70826-3 PTRIEX-2 DNA 4370
70836-3 ORIGAMI B COMPETENT CELLS 1858
70836-4 ORIGAMI B COMPETENT CELLS 3432
70837-3 ORIGAMI B(DE3) COMPETENT CELLS 1858
70837-4 ORIGAMI B(DE3) COMPETENT CELLS 3432
70838-3 ORIGAMI B(DE3)PLACI COMPETENT CELLS 1916
70838-4 ORIGAMI B(DE3)PLACI COMPETENT CELLS 3528
70839-3 ORIGAMI B(DE3)PLYSS COMP CELLS 1858
70839-4 ORIGAMI B(DE3)PLYSS COMP CELLS 3432
70840-3 PTRIEX-1.1 DNA 4370
70846-3 TRIEXUP PRIMER 1401
70847-3 TRIEXDOWN PRIMER 1401
70850-3 FASTPLAX TITER KIT 3369
70852-3 SPINPREP GEL DNA KIT 2157
70856-3 RNASE A SOLUTION 785
70899-3 NI-NTA BUFFER KIT 1618
70905-3 PTRIEX-4 EK/LIC VECTOR KIT 7139
70909-3 REPORTASOL EXTRACTION BUFFER 883
70909-4 REPORTASOL EXTRACTION BUFFER 3431
70911-3 ORIGAMI B COMPETENT CELL SET 3795
70912-3 MAGPREP SILICA PARTICLES 1185
70920-3 ROSETTA(DE3)PLACI COMP CELLS 1858
70920-4 ROSETTA(DE3)PLACI COMP CELLS 3432
70921-3 BUGBUSTER 10X 966
70921-4 BUGBUSTER 10X 4284
70921-5 BUGBUSTER 10X 8018
70922-3 BUGBUSTER HT 1867
70922-4 BUGBUSTER HT 7285
70922-5 BUGBUSTER HT 12651
70923-3 BUGBUSTER (PRIMARY AMINE-FREE) 1101
70923-4 BUGBUSTER (PRIMARY AMINE-FREE) 4367
70927-3 PTRIEX-1.1 NEO DNA 5288
70928-3 PTRIEX-1.1 HYGRO DNA 5288
70929-3 PTRIEX-2 NEO DNA 5288
70930-3 PTRIEX-2 HYGRO DNA 5076
70931-3 PTRIEX-3 NEO DNA 5288
70932-3 PTRIEX-3 HYGRO DNA 5288
70933-3 PTRIEX-4 NEO DNA 5288
70934-3 PTRIEX-4 HYGRO DNA 5288
70939-3 PET-43.1A(+) DNA 3754
70940-3 PET-43.1B(+) DNA 3754
70941-3 PET-43.1C(+) DNA 3754
70942-3 PET SYSTEM 43.1 8578
70943-3 PET SYSTEM 43.1 + CC 10334
70953-3 ROSETTA COMPETENT CELLS 1858
70953-4 ROSETTA COMPETENT CELLS 3432
70954-3 ROSETTA(DE3) COMPETENT CELLS 1858
70954-4 ROSETTA(DE3) COMPETENT CELLS 3432
70955-3 5% ALKALI-SOLUBLE CASEIN 853
70956-3 ROSETTA(DE3)PLYSS COMP CELLS 1858
70956-4 ROSETTA(DE3)PLYSS COMP CELLS 3432
70967-3 GENEJUICE TRANSFECTION REAGENT 4612
70967-4 GENEJUICE TRANSFECTION REAGENT 36882
70967-5 GENEJUICE TRANSFECTION REAGENT 2214
70967-6 GENEJUICE TRANSFECTION REAGENT 19647
70971-3 HIS*BIND COLUMNS 1664
70971-4 HIS*BIND COLUMNS 7424
70972-3 HIS*TAG AP WESTERN REAGENTS 4924
70973-3 HIS*TAG AP LUMIBLOT REAGENTS 5388
70974-3 HIS*TAG HRP LUMIBLOT REAGENTS 4991
70976-3 SPINPREP PCR CLEAN-UP KIT 2249
70978-3 BETARED B-GAL ASSAY KIT 6544
70979-3 BETAFLUOR B-GAL ASSAY KIT 6544
70980-3 TRAIL MIX PROTEIN MARKERS 1869
70982-3 TRAIL MIX WESTERN MARKERS 1195
71002-3 HIS*MAG AGAROSE BEADS 1869
71002-4 HIS*MAG AGAROSE BEADS 7206
71003-3 NOVATAQ DNA POLYMERASE 636
71003-4 NOVATAQ DNA POLYMERASE 2541
71003-5 NOVATAQ DNA POLYMERASE 10162
71004-3 10MM DNTP MIX 803
71007-3 NOVATAQ PCR MASTER MIX 2374
71009-3 CYTOBUSTER PROTEIN EXTRACTION REAGENT 915
71009-4 CYTOBUSTER PROTEIN EXTRACTION REAGENT 3463
71011-3 HT96 NOVABLUE COMP CELLS 6406
71011-4 HT96 NOVABLUE COMP CELLS 23988
71012-3 HT96 BL21(DE3) COMP CELLS 6406
71012-4 HT96 BL21(DE3) COMP CELLS 23988
71013-3 COLIROLLERS PLATING BEADS 233
71013-4 COLIROLLERS PLATING BEADS 868
71022-3 TRIEX INSECT CELL MEDIUM 1408
71023-3 TRIEX SF9 CELLS 1618
71030-3 COLUMN EXTENSION FUNNELS 347
71034-3 ROSETTABLUE(DE3)PLYSS COMP CELLS 1858
71034-4 ROSETTABLUE(DE3)PLYSS COMP CELLS 3432
71035-3 HIS*BIND RESIN, NI-CHARGED 1729
71035-4 HIS*BIND RESIN, NI-CHARGED 3520
71035-5 HIS*BIND RESIN, NI-CHARGED 13929
71045-3 GOAT ANTI-MOUSE IGG HRP CONJUGATE 1018
71047-3 TRAIL MIX AP WESTERN BLOT KIT 2582
71048-3 TRAIL MIX HRP WESTERN BLOT KIT 3222
71049-3 PROTEINASE K SOLUTION, 600MAU/ML 951
71049-4 PROTEINASE K SOLUTION, 600MAU/ML 3520
71058-3 ROSETTABLUE COMP CELLS 1858
71058-4 ROSETTABLUE COMP CELLS 3432
71059-3 ROSETTABLUE(DE3) COMP CELLS 1858
71059-4 ROSETTABLUE(DE3) COMP CELLS 3432
71060-3 ROSETTABLUE(DE3)PLACI COMP CELLS 1858
71060-4 ROSETTABLUE(DE3)PLACI COMP CELLS 3432
71071-3 PET-41 EK/LIC VECTOR KIT 7506
71072-3 PET-43.1 EK/LIC VECTOR KIT 7506
71074-3 BETABLUE STAINING KIT 1907
71077-3 X-GAL SOLUTION 1317
71078-3 REDALERT 10X WESTERN BLOT STAIN 785
71079-3 ROSETTABLUE COMP CELL SET 3795
71084-3 GST*MAG AGAROSE BEADS 3872
71084-4 GST*MAG AGAROSE BEADS 16101
71085-3 KOD DNA POLYMERASE 4028
71086-3 KOD HOT START DNA POLYMERASE 3335
71086-4 KOD HOT START DNA POLYMERASE 12939
71086-5 KOD HOT START DNA POLYMERASE 803
71087-3 KOD XL DNA POLYMERASE 4453
71087-4 KOD XL DNA POLYMERASE 17763
71091-3 NOVATAQ HOT START DNA POLYMERASE 2207
71091-4 NOVATAQ HOT START DNA POLYMERASE 8825
71092-3 POPCULTURE REAGENT 718
71092-4 POPCULTURE REAGENT 3036
71092-5 POPCULTURE REAGENT 9058
71097-3 GST*TAG MONOCLONAL ANTIBODY 2820
71097-4 GST*TAG MONOCLONAL ANTIBODY 11026
71101-3 MAGNETIGHT HT96 STAND 5339
71102-3 ROBOPOP GST*MAG PURIFICATION KIT 8517
71103-3 ROBOPOP HIS*MAG PURIFICATION KIT 6521
71104-3 SF9 INSECT CELLS 1666
71110-3 RLYSOZYME SOLUTION 546
71110-4 RLYSOZYME SOLUTION 1289
71110-5 RLYSOZYME SOLUTION 5221
71111-3 STERILE 96DEEPWELL CULTURE PLATE W/SEALS 2014
71112-3 COLLECTION PLATE AND SEALER 227
71113-3 POPCULTURE GST*MAG PURIFICATION KIT 9813
71114-3 POPCULTURE HIS*MAG PURIFICATION KIT 5454
71115-3 RIBOJUICE SIRNA TRANSFECTION REAGENT 3143
71115-4 RIBOJUICE SIRNA TRANSFECTION REAGENT 7455
71122-3 PET-44A(+) DNA 3754
71123-3 PET-44B(+) DNA 3754
71124-3 PET-44C(+) DNA 3754
71125-3 PET NUSA FUSION SYSTEM 8578
71126-3 PET NUSA FUSION SYSTEM 44 PLUS CC 10334
71127-3 NUS*TAG MONOCLONAL ANTIBODY 2820
71127-4 NUS*TAG MONOCLONAL ANTIBODY 11026
71129-3 PETCOCO-1 DNA 5288
71131-3 PETCOCO-1 SYSTEM 8215
71135-3 ROSETTA-GAMI B COMPETENT CELLS 1858
71135-4 ROSETTA-GAMI B COMPETENT CELLS 3432
71136-3 ROSETTA-GAMI B(DE3) COMPETENT CELLS 1858
71136-4 ROSETTA-GAMI B(DE3) COMPETENT CELLS 3432
71137-3 ROSETTA-GAMI B(DE3)PLYSS COMP. CELLS 1858
71137-4 ROSETTA-GAMI B(DE3)PLYSS COMP. CELLS 3432
71138-3 ROSETTA-GAMI B(DE3)PLACI COMP. CELLS 2870
71138-4 ROSETTA-GAMI B(DE3)PLACI COMP. CELLS 3644
71144-3 PET-44 EK/LIC VECTOR KIT 7506
71146-3 PETDUET-1 DNA 5430
71147-3 PACYC DUET-1 DNA 5430
71148-3 PETCOCO-2 DNA 5288
71149-3 PETCOCO-2 SYSTEM 8215
71177-3 ROSETTA-GAMI B COMPETENT CELL SET 3795
71178-3 ACYCDUETUP1 PRIMER 1401
71179-3 DUETDOWN1 PRIMER 1401
71180-3 DUETUP2 PRIMER 1401
71183-3 NUCBUSTER PROTEIN EXTRACTION KIT 3018
71184-3 HIS*TAG ANTIBODY PLATE 1746
71184-4 HIS*TAG ANTIBODY PLATE 5031
71186-3 YEASTBUSTER PROTEIN EXTRACTION REAGENT 1194
71186-4 YEASTBUSTER PROTEIN EXTRACTION REAGENT 4905
71187-3 INSECT POPCULTURE REAGENT 1935
71187-4 INSECT POPCULTURE REAGENT 7607
71188-3 ROBOPOP NI-NTA HIS*BIND PURIFICATION KIT 11894
71189-3 ROBOPOP GST*BIND PURIFICATION KIT 11899
71194-3 0.5 M THP SOLUTION 501
71194-4 0.5 M THP SOLUTION 1885
71195-3 HT96 ISOTHERMAL BLOCK 3419
71196-3 2-ML 96-WELL FILTER PLATE 694
71205-3 BENZONASE NUCLEASE HC, PURITY > 90% 2586
71206-3 BENZONASE NUCLEASE HC, PURITY > 99% 4984
71207-3 (DE3) COMPETENT CELL SET 1 3552
71208-3 (DE3) COMPETENT CELL SET 2 3552
71209-3 (DE3)PLYSS COMPETENT CELL SET 1 3552
71210-3 (DE3)PLYSS COMPETENT CELL SET 2 3552
71211-3 NON-LAMBDA DE3 LYSOGEN COMP. CELL SET 3552
71227-3 NOVABLUE GIGASINGLES COMPETENT CELLS 2352
71227-4 NOVABLUE GIGASINGLES COMPETENT CELLS 4521
71228-3 PSTBLUE-1 ACCEPTOR VECTOR GIGA KIT 4621
71228-4 PSTBLUE-1 ACCEPTOR VECTOR GIGA KIT 7707
71229-3 PSTBLUE-1 PERF. BLUNT GIGA CLONING KIT 4621
71229-4 PSTBLUE-1 PERF. BLUNT GIGA CLONING KIT 7707
71230-3 LYSONASE BIOPROCESSING REAGENT 1885
71230-4 LYSONASE BIOPROCESSING REAGENT 5838
71230-5 LYSONASE BIOPROCESSING REAGENT 23054
71232-3 PBIEX-3 DNA 4504
71233-3 PBIEX-2 DNA 4504
71234-3 PBIEX-1 DNA 4504
71235-3 PIEX-4 DNA 4370
71237-3 PIEX-1 EK/LIC VECTOR KIT 6973
71238-3 PIEX-2 DNA 4370
71240-3 PIEX-2 EK/LIC VECTOR KIT 6973
71241-3 PIEX-1 DNA 4370
71242-3 PIEX-5 DNA 4370
71243-3 PIEX-3 DNA 4370
71245-3 PIEX-3 EK/LIC VECTOR KIT 6973
71247-3 IE1 TERMINATOR PRIMER 1401
71251-3 VEGGIE NOVABLUE SINGLES COMPETENT CELLS 2846
71251-4 VEGGIE NOVABLUE SINGLES COMPETENT CELLS 5470
71252-3 VEGGIE BL21(DE3) SINGLES COMPETENT CELLS 2846
71252-4 VEGGIE BL21(DE3) SINGLES COMPETENT CELLS 5430
71253-3 VEGGIE BL21(DE3)PLYSS SINGLES COMP CELLS 2846
71253-4 VEGGIE BL21(DE3)PLYSS SINGLES COMP CELLS 5430
71255-3 ROBOPOP SOLUBILITY SCREENING KIT 3287
71256-3 MAGPREP BACTERIAL GENOMIC DNA KIT 4214
71257-3 INSECT ROBOPOP NI-NTA HISBIND PURIF. KIT 7374
71258-3 SOLUBILITY SCREENING 96WELL FILTER PLATE 817
71259-3 INSECT GENEJUICE TRANSFECTION REAGENT 1068
71259-4 INSECT GENEJUICE TRANSFECTION REAGENT 2252
71259-5 INSECT GENEJUICE TRANSFECTION REAGENT 17915
71263-3 ORIGAMI B 5615 GLYCEROL STOCK 2038
71264-3 ROSETTA-GAMI B 5615 GLYCEROL STOCK 2038
71266-3 ROSETTA 5615 GLYCEROL STOCK 2038
71279-3 VEGGIE YEAST EXTRACT 1772
71280-3 VEGGIE PEPTONE 7768
71281-3 PROTEOJUICE PROTEIN TRANSFECTION REAGENT 5087
71281-4 PROTEOJUICE PROTEIN TRANSFECTION REAGENT 16325
71282-3 EMSA ACCESSORY KIT 1839
71283-3 PTANDEM-1 DNA 5793
71284-3 PTK-NEO DNA 3856
71285-3 BCA PROTEIN ASSAY KIT 2652
71289-3 5X ANTIGENPLUS BUFFER (PH 6) 1092
71290-3 5X ANTIGENPLUS BUFFER (PH 10) 751
71291-3 5X ANTIGENPLUS BUFFER (PH 7.4) 751
71292-3 ANTIGENPLUS BUFFER SET 1839
71296-3 PHOSPHOSAFE EXTRACTION REAGENT 1257
71296-4 PHOSPHOSAFE EXTRACTION REAGENT 5087
71300-3 OVERNIGHT EXPRESS AUTOINDUCTION SYSTEM 1 1151
71300-4 OVERNIGHT EXPRESS AUTOINDUCTION SYSTEM 1 4486
71318-3 NOVABLUE T1R SINGLES COMPETENT CELLS 2664
71318-4 NOVABLUE T1R SINGLES COMPETENT CELLS 5127
71321-3 LIC DUET T7*TAG EK ADAPTOR 3570
71322-3 LIC DUET TRX*TAG EK ADAPTOR 3570
71323-3 LIC DUET GST*TAG EK ADAPTOR 3570
71324-3 LIC DUET NUS*TAG EK ADAPTOR 3570
71327-3 PET-45B(+) DNA 3754
71328-3 PET EXPRESSION SYSTEM 45B 5187
71329-3 PET EXPRESSION SYSTEM 45B PLUS CC 6823
71330-3 PCDF-1B DNA 3754
71331-3 PCDF-1 EXPRESSION SYSTEM 5187
71332-3 PCDF-1 EXPRESSION SYSTEM + COMP. CELLS 6825
71333-3 PIEX-6 DNA 4370
71335-3 PET-46 EK/LIC VECTOR KIT 7506
71337-3 PCDF-2 EK/LIC VECTOR KIT 7506
71339-3 PIEX-7 EK/LIC VECTOR KIT 6973
71340-3 PCDFDUET-1 DNA 5430
71341-3 PRSFDUET-1 DNA 5430
71344-3 ORIGAMI 2 COMPETENT CELLS 1858
71344-4 ORIGAMI 2 COMPETENT CELLS 3432
71345-3 ORIGAMI 2(DE3) COMPETENT CELLS 1858
71345-4 ORIGAMI 2(DE3) COMPETENT CELLS 3432
71346-3 ORIGAMI 2(DE3)PLYSS COMPETENT CELLS 1916
71346-4 ORIGAMI 2(DE3)PLYSS COMPETENT CELLS 3528
71347-3 ORIGAMI 2(DE3)PLACI COMPETENT CELLS 1974
71347-4 ORIGAMI 2(DE3)PLACI COMPETENT CELLS 3798
71348-3 ORIGAMI 2(DE3) GLYCEROL STOCK 2038
71349-3 ORIGAMI 2(DE3)PLYSS GLYCEROL STOCK 2038
71350-3 ROSETTA-GAMI 2 COMPETENT CELLS 1858
71350-4 ROSETTA-GAMI 2 COMPETENT CELLS 3432
71351-3 ROSETTA-GAMI 2(DE3) COMPETENT CELLS 1858
71351-4 ROSETTA-GAMI 2(DE3) COMPETENT CELLS 3432
71352-3 ROSETTA-GAMI 2(DE3)PLYSS COMP. CELLS 1858
71352-4 ROSETTA-GAMI 2(DE3)PLYSS COMP. CELLS 3432
71353-3 ROSETTA-GAMI 2(DE3)PLACI COMP. CELLS 2051
71353-4 ROSETTA-GAMI 2(DE3)PLACI COMP. CELLS 3972
71362-3 LIC DUET MINIMAL ADAPTOR 3427
71363-3 PRSF-1B DNA 3754
71364-3 PRSF-2 EK/LIC VECTOR KIT 7506
71366-3 OVERNIGHT EXPRESS AUTOINDUCTION SYSTEM 2 1985
71366-4 OVERNIGHT EXPRESS AUTOINDUCTION SYSTEM 2 7921
71370-3 BUGBUSTER PLUS LYSONASE KIT 2633
71370-4 BUGBUSTER PLUS LYSONASE KIT 8267
71375-3 PRSF EXPRESSION SYSTEM 1 5187
71376-3 PRSF EXPRESSION SYSTEM 1 + COMP. CELLS 6825
71377-3 NOSHIFT TRANSCRIPTION FACTOR ASSAY KIT 6569
71378-3 NOSHIFT TRANSCR. FACTOR ASSAY+NUCBUSTER 8672
71397-3 ROSETTA 2(DE3) COMPETENT CELLS 1858
71397-4 ROSETTA 2(DE3) COMPETENT CELLS 3432
71400-3 ROSETTA 2(DE3) SINGLES COMPETENT CELLS 2422
71400-4 ROSETTA 2(DE3) SINGLES COMPETENT CELLS 4541
71401-3 ROSETTA 2(DE3)PLYSS SINGLES COMP. CELLS 2422
71401-4 ROSETTA 2(DE3)PLYSS SINGLES COMP. CELLS 4541
71402-3 ROSETTA 2 COMPETENT CELLS 1858
71402-4 ROSETTA 2 COMPETENT CELLS 3432
71403-3 ROSETTA 2(DE3)PLYSS COMPETENT CELLS 1858
71403-4 ROSETTA 2(DE3)PLYSS COMPETENT CELLS 3432
71404-3 ROSETTA 2(DE3)PLACI COMPETENT CELLS 1858
71404-4 ROSETTA 2(DE3)PLACI COMPETENT CELLS 3432
71405-3 ROSETTA 2 COMPETENT CELL SET 3795
71406-3 PCOLADUET-1 DNA 5430
71408-3 ORIGAMI 2(DE3) SINGLES COMPETENT CELLS 2422
71408-4 ORIGAMI 2(DE3) SINGLES COMPETENT CELLS 4541
71412-3 CHICKEN EGG WHITE LYSOZYME, 10 MG/ML 1070
71431-3 ORIGAMI 2 COMPETENT CELL SET * 3910
71432-3 ROSETTA-GAMI 2 COMPETENT CELL SET 3910
71437-3 GST*TAG ANTIBODY PLATE 1832
71437-4 GST*TAG ANTIBODY PLATE 7527
71438-3 PROTEOENRICH ATP-BINDERS KIT 6206
71445-3 ATP-BINDERS RESIN 2569
71456-3 BUGBUSTER MASTER MIX 2377
71456-4 BUGBUSTER MASTER MIX 7307
71461-3 PET-47B(+) DNA 3754
71462-3 PET-48B(+) DNA 3754
71463-3 PET-49B(+) DNA 3754
71464-3 PET-50B(+) DNA 3754
71465-3 PET EXPRESSION SYSTEM 47B 5187
71466-3 PET EXPRESSION SYSTEM 47B PLUS CC 6823
71467-3 PET EXPRESSION SYSTEM 48B 5187
71468-3 PET EXPRESSION SYSTEM 48B PLUS CC 6823
71469-3 PET EXPRESSION SYSTEM 49B 5187
71470-3 PET EXPRESSION SYSTEM 49B PLUS CC 6825
71471-3 PET EXPRESSION SYSTEM 50B 5187
71472-3 PET EXPRESSION SYSTEM 50B PLUS CC 6823
71491-3 OVERNIGHT EXPRESS INSTANT TB MEDIUM 718
71491-4 OVERNIGHT EXPRESS INSTANT TB MEDIUM 2835
71491-5 OVERNIGHT EXPRESS INSTANT TB MEDIUM 6954
71493-3 HRV 3C PROTEASE 3287
71504-3 D-TUBE DIALYZER MINI, MWCO 6-8 KDA 758
71505-3 D-TUBE DIALYZER MINI, MWCO 12-14 KDA 758
71506-3 D-TUBE DIALYZER MIDI, MWCO 3.5 KDA 1152
71507-3 D-TUBE DIALYZER MIDI, MWCO 6-8 KDA 1152
71508-3 D-TUBE DIALYZER MAXI, MWCO 3.5 KDA 1401
71509-3 D-D-TUBE DIALYZER MAXI, MWCO 6-8 KDA 1401
71510-3 D-TUBE DIALYZER MAXI, MWCO 12-14 KDA 1401
71511-3 D-TUBE ELECTROELUTION ACCESSORY KIT 818
71512-3 FLOATING RACK, MINI 281
71513-3 FLOATING RACK, MIDI 301
71514-3 FLOATING RACK, MAXI 482
71518-3 NOSHIFT NF-KB (P65) REAGENTS 3811
71530-3 T7 TAIL FIBER MONOCLONAL ANTIBODY 2853
71531-3 T7 PHAGE CAPTURE PLATE 1221
71531-4 T7 PHAGE CAPTURE PLATE 4780
71532-3 PROTEOENRICH CAT-X KIT 3075
71537-3 TAG*OFF HIGH ACTIVITY REK 1968
71539-3 PROTEOENRICH CAT-X SEC KIT 3377
71540-3 TAG*OFF REK CLEAVAGE CAPTURE KIT 3417
71542-3 TRX*TAG MONOCLONAL ANTIBODY 2786
71545-3 BACMAGIC DNA KIT 8318
71546-3 BACMAGIC TRANSFECTION KIT 11299
71549-3 S*TAG MONOCLONAL ANTIBODY 2786
71552-3 IFOLD PROTEIN REFOLDING SYSTEM 1 6456
71553-3 PET-51B(+) DNA 3754
71554-3 PET-52B(+) DNA 3754
71555-3 PIEX-8 DNA 4370
71556-3 PIEX-9 DNA 4370
71557-3 PIEX-10 DNA 4370
71558-3 PTRIEX-5 DNA 4370
71559-3 PTRIEX-6 DNA 4370
71560-3 PTRIEX-7 DNA 4370
71561-1UG PET-51 EK/LIC VECTOR 2370
71570-3 PET-51 EK/LIC VECTOR KIT 7506
71571-3 PET-52 3C/LIC VECTOR KIT 7506
71572-3 PIEX-8 EK/LIC VECTOR KIT 6973
71573-3 PIEX-9 3C/LIC VECTOR KIT 7180
71574-3 PIEX-10 EK/LIC VECTOR KIT 6973
71575-3 PTRIEX-5 EK/LIC VECTOR KIT 7139
71576-3 PTRIEX-6 3C/LIC VECTOR KIT 7139
71577-3 PTRIEX-7 EK/LIC VECTOR KIT 7139
71586-3 M6 ADAPTOR SET 3053
71587-3 1/4-28 ADAPTOR SET 3055
71588-3 10-32 ADAPTOR SET 1866
71589-3 1/16 INCH ADAPTOR SET 2327
71590-3 STREP*TAG II MONOCLONAL ANTIBODY 7546
71590-3 STREP*TAG II MONOCLONAL ANTIBODY 7546
71591-3 STREP*TAG II ANTIBODY HRP CONJUGATE 4315
71592-3 STREP*TACTIN SUPERFLOW AGAROSE 2650
71592-4 STREP*TACTIN SUPERFLOW AGAROSE 10129
71593-3 STREP*TACTIN SUPERFLOW COLUMN, 1 ML 10095
71594-3 STREP*TACTIN SUPERFLOW COLUMN, 0.2 ML 9279
71597-3 STREP*TACTIN MACROPREP RESIN 2729
71597-4 STREP*TACTIN MACROPREP RESIN 10129
71598-3 STREP*TACTIN MACROPREP CARTRIDGE 12719
71603-3 10X STREP*TACTIN WASH BUFFER 1081
71604-3 10X STREP*TACTIN ELUTION BUFFER 1267
71605-3 STREP*TACTIN HT96 PURIFICATION KIT 10593
71608-3 STREP*TACTIN SPINPREP KIT 5812
71609-3 BIOTIN BLOCKING BUFFER 2056
71610-3 D-DESTHIOBIOTIN 4368
71612-3 10X STREP*TACTIN REGENERATION BUFFER 2119
71613-3 STREP*TACTIN BUFFER KIT 4619
71614-3 STREPTAG II PROT. MKRS, 16-100KDA,LYOPH. 3354
71615-3 INTRODUCTORY STREP*TAG II KIT, PET-51B 6228
71616-3 INTRODUCTORY STREP*TAG II KIT, PET-52B 6228
71624-3 ONE-STREP PROTEIN INTERACTION KIT 20345
71649-3 NI-MAC CARTRIDGE 1508
71649-4 NI-MAC CARTRIDGE 3166
71650-3 CO-MAC CARTRIDGE 2507
71650-4 CO-MAC CARTRIDGE 5858
71651-3 U-MAC CARTRIDGE 3923
71658-3 NI-MAC PURIFICATION KIT 5984
71659-3 CO-MAC PURIFICATION KIT 7018
71676-3 NOVATAQ HOT START MASTER MIX KIT 2925
71676-4 NOVATAQ HOT START MASTER MIX KIT 13037
71712-3 D-TUBE96 DIALYZER, 6-8 KDA 6156
71713-3 D-TUBE96 DIALYZER, 12-14 KDA 6156
71719-3 IFOLD PROTEIN REFOLDING SYSTEM 2 6652
71724-3 PIEX/BAC-1 DNA 4804
71726-3 PIEX/BAC-3 DNA 4804
71727-3 PIEX/BACTM-4 DNA 3714
71728-3 PIEX/BACTM-5 DNA 3714
71729-3 PIEX/BAC-1 EK/LIC VECTOR KIT 7590
71731-3 PIEX/BAC-3 3C/LIC VECTOR KIT 7590
71732-3 PIEX/BACTM-4 EK/LIC VECTOR KIT 7590
71733-3 PIEX/BACTM-5 3C/LIC VECTOR KIT 7590
71739-3 D-TUBE DIALYZER MEGA, 10ML, MWCO 3.5 KDA 1705
71739-4 D-TUBE DIALYZER MEGA, 10ML, MWCO 3.5 KDA 6820
71740-3 D-TUBE DIALYZER MEGA, 10ML, MWCO 6-8 KDA 1705
71740-4 D-TUBE DIALYZER MEGA, 10ML, MWCO 6-8 KDA 7303
71742-3 D-TUBE DIALYZER MEGA, 15ML, MWCO 3.5 KDA 1755
71742-4 D-TUBE DIALYZER MEGA, 15ML, MWCO 3.5 KDA 7020
71743-3 D-TUBE DIALYZER MEGA, 15ML, MWCO 6-8 KDA 1755
71743-4 D-TUBE DIALYZER MEGA, 15ML, MWCO 6-8 KDA 7020
71745-3 D-TUBE DIALYZER MEGA, 20ML, MWCO 3.5 KDA 1806
71745-4 D-TUBE DIALYZER MEGA, 20ML, MWCO 3.5 KDA 7237
71746-3 D-TUBE DIALYZER MEGA, 20ML, MWCO 6-8 KDA 1806
71746-4 D-TUBE DIALYZER MEGA, 20ML, MWCO 6-8 KDA 7753
71748-3 FLOATING RACK, MEGA 484
71749-3 GST BIND FRACTOGEL CARTRIDGE 1835
71749-4 GST BIND FRACTOGEL CARTRIDGE 4354
71751-3 LB BROTH LENNOX 485
71751-4 LB BROTH LENNOX 2106
71751-5 LB BROTH LENNOX 1032
71751-6 LB BROTH LENNOX 7974
71752-3 LB AGAR, MILLER 752
71752-4 LB AGAR, MILLER 4784
71752-5 LB AGAR, MILLER 1418
71752-6 LB AGAR, MILLER 10859
71753-3 LB BROTH MILLER 517
71753-4 LB BROTH MILLER 2204
71753-5 LB BROTH MILLER 865
71753-6 LB BROTH MILLER 6510
71754-3 TERRIFIC BROTH 1062
71754-4 TERRIFIC BROTH 7655
71754-5 TERRIFIC BROTH 14745
71755-3 2XYT BROTH 948
71755-4 2XYT BROTH 10579
71757-3 OVERNIGHT EXPRESS INSTANT LB MEDIUM 718
71757-4 OVERNIGHT EXPRESS INSTANT LB MEDIUM 2835
71757-5 OVERNIGHT EXPRESS INSTANT LB MEDIUM 6954
71759-3 ONEX AUTOINDUCTION NMR MEDIUM - 15N 4496
71759-4 ONEX AUTOINDUCTION NMR MEDIUM - 15N 18709
71760-3 ONEX AUTOINDUCTION NMR MEDIUM-OPTIMIZA. 2073
71766-3 STREP•TACTIN SUPERFLOW HP CARTRIDGE,1ML 12411
71767-3 STREP•TACTIN SUPERFLOW HP CARTRIDGES,5ML 6502
71767-4 STREP•TACTIN SUPERFLOW HP CARTRIDGES,5ML 31020
71769-3 LUER LOCK SYRINGE ADAPTOR SET (HP) 1616
71770-3 COUPLING ADAPTOR SET (HP) 1617
71771-3 PROTEOEXTRACT S-PEK ANTIBODY CONTROL KIT 5404
71772-3 PE TRANSMEMBRANE PROTEIN EXTRACTION KIT 6014
71777-3 PROTEOEXTRACT COLLAGENASE SET 2402
71782-3 WS EPITAG ERK PATHWAY PANEL I COMPLETE 28409
71783-3 WIDESCREEN REAGENT KIT 3494
71784-3 EPITAG CELL LYSIS KIT 1244
71785-3 EPITAG DIGEST KIT 1244
71789-3 ONEX AUTOINDUCTION NMR MEDIUM - 15N, 13C 5767
71791-3 EPITAG ERK PATHWAY STANDARDS MIX 978
71794-3 EPITAG COMBO KIT 5499
71826-3 EPITAG ERK PATHWAY PANEL I 23227
71829-3 EPITAG ERK1 TOTAL BEAD KIT 4929
71830-3 EPITAG ERK2 TOTAL BEAD KIT 4929
71831-3 EPITAG B-RAF (PS446) BEAD KIT 4929
71832-3 EPITAG MEK1/2(S217,S221/S222,S226) BDKIT 4929
71833-3 EPITAG ERK1 (PT202, PY204) BEAD KIT 4929
71834-3 EPITAG ERK2 (PT185, PY187) BEAD KIT 4929
71835-3 EPITAG MEK1 TOTAL BEAD KIT 4929
71836-3 EPITAG MEK2 TOTAL BEAD KIT 4929
71837-3 EPITAG STAT1 TOTAL BEAD KIT 4973
71838-3 EPITAG RAF1 TOTAL BEAD KIT 4929
71839-3 EPITAG RAF1(PS338) BEAD KIT 4929
71840-3 HIS*TAG ANTIBODY HRP CONJUGATE KIT 6397
71842-3 KOD HOT START MASTER MIX 2618
71842-4 KOD HOT START MASTER MIX 10355
71844-3 GATEWAY NOVA PET-53-DEST DNA 3687
71845-3 GATEWAY NOVA PET-54-DEST DNA 3687
71846-3 GATEWAY NOVA PET-55-DEST DNA 3687
71847-3 GATEWAY NOVA PET-56-DEST DNA 3687
71848-3 GATEWAY NOVA PET-57-DEST DNA 3687
71849-3 GATEWAY NOVA PET-58-DEST DNA 3687
71850-3 GATEWAY NOVA PET-59-DEST DNA 3687
71851-3 GATEWAY NOVA PET-60-DEST DNA 3687
71852-3 GATEWAY NOVA PET-61-DEST DNA 3687
71853-3 GATEWAY NOVA PET-62-DEST DNA 3687
71854-3 GATEWAY NOVA PCOLA-3-DEST DNA 3687
71855-3 GATEWAY NOVA PCOLA-2-DEST DNA 3687
71856-3 GATEWAY NOVA PET-53-DEST EXP SYSTEM 8508
71857-3 GATEWAY NOVA PET-54-DEST EXP SYSTEM 8508
71858-3 GATEWAY NOVA PET-55-DEST EXP SYSTEM 8508
71859-3 GATEWAY NOVA PET-56-DEST EXP SYSTEM 8508
71860-3 GATEWAY NOVA PET-57-DEST EXP SYSTEM 8508
71861-3 GATEWAY NOVA PET-58-DEST EXP SYSTEM 9113
71862-3 GATEWAY NOVA PET-59-DEST EXP SYSTEM 9113
71863-3 GATEWAY NOVA PET-60-DEST EXP SYSTEM 8508
71864-3 GATEWAY NOVA PET-61-DEST EXP SYSTEM 8508
71865-3 GATEWAY NOVA PET-62-DEST EXP SYSTEM 8508
71866-3 GATEWAY NOVA PCOLA-3-DEST EXPSYSTM 9119
71867-3 GATEWAY NOVA PCOLA-2-DEST EXPSYSTM 9113
71868-3 NOVAF- SINGLES COMPETENT CELLS 1902
71868-4 NOVAF- SINGLES COMPETENT CELLS 3555
71872-3 U-TUBE CONCENTRATOR, 500-3 634
71872-4 U-TUBE CONCENTRATOR, 500-3 1435
71873-3 U-TUBE CONCENTRATOR, 500-10 634
71873-4 U-TUBE CONCENTRATOR, 500-10 1435
71874-3 U-TUBE CONCENTRATOR, 500-30 634
71874-4 U-TUBE CONCENTRATOR, 500-30 1435
71875-3 U-TUBE CONCENTRATOR, 2H-2 1001
71875-4 U-TUBE CONCENTRATOR, 2H-2 1735
71876-3 U-TUBE CONCENTRATOR, 2-10 735
71876-4 U-TUBE CONCENTRATOR, 2-10 1685
71877-3 U-TUBE CONCENTRATOR, 2-30 735
71877-4 U-TUBE CONCENTRATOR, 2-30 1685
71878-3 U-TUBE CONCENTRATOR, 6-3 900
71878-4 U-TUBE CONCENTRATOR, 6-3 2069
71879-3 U-TUBE CONCENTRATOR, 6-10 900
71879-4 U-TUBE CONCENTRATOR, 6-10 2069
71880-3 U-TUBE CONCENTRATOR, 6-30 900
71880-4 U-TUBE CONCENTRATOR, 6-30 2069
71881-3 U-TUBE CONCENTRATOR, 15H-5 1452
71881-4 U-TUBE CONCENTRATOR, 15H-5 3369
71882-3 U-TUBE CONCENTRATOR, 15H-30 1452
71882-4 U-TUBE CONCENTRATOR, 15H-30 3369
71883-3 U-TUBE CONCENTRATOR, 20-3 1702
71883-4 U-TUBE CONCENTRATOR, 20-3 3920
71884-3 U-TUBE CONCENTRATOR, 20-10 1702
71884-4 U-TUBE CONCENTRATOR, 20-10 3920
71885-3 U-TUBE CONCENTRATOR, 20-30 1702
71885-4 U-TUBE CONCENTRATOR, 20-30 3920
71890-3 EPITAG ERK PATHWAY PANEL II 22913
71891-3 WS EPITAG ERK PATHWAY PANEL II COMPLETE 27832
71892-3 IFOLD  PROTEIN REFOLDING SYSTEM 3 7223
71894-3 FOLDACE REAGENT 1 7354
71895-3 FOLDACE REAGENT 2 6438
71896-3 FOLDACE REAGENT 3 6438
71897-3 FOLDACE  REAGENT 4 7163
71898-3 FOLDACE  REAGENT 5 8357
71899-3 FOLDACE  REAGENT 6 5391
71900-3 NANOJUICE CORE TRANSFECTION REAGENT 3676
71901-3 NANOJUICE TRANSFECTION BOOSTER 2731
71902-3 NANOJUICE TRANSFECTION KIT 1218
71902-4 NANOJUICE TRANSFECTION KIT 7484
71924-3 RTK TOTAL 7-PLEX 24552
71925-3 RTK PTYR 7-PLEX 22823
71926-3 CELL EXTRACTION KIT 1581
71928-3 EGFR TOTAL BEAD KIT 3912
71929-3 IGF-1R TOTAL BEAD KIT 4214
71930-3 HGFR TOTAL BEAD KIT 3912
71931-3 PDGFRBETA TOTAL BEAD KIT 3912
71932-3 HER-2 TOTAL BEAD KIT 3912
71933-3 VEGFR2 TOTAL BEAD KIT 4890
71934-3 TIE-2 TOTAL BEAD KIT 3912
71935-3 EGFR PTYR BEAD KIT 3651
71936-3 IGF-1R PTYR BEAD KIT 3933
71937-3 HGFR PTYR BEAD KIT 3651
71938-3 PDGFRBETA PTYR BEAD KIT 3651
71939-3 HER-2 PTYR BEAD KIT 3651
71940-3 VEGFR2 PTYR BEAD KIT 3651
71941-3 TIE-2 PTYR BEAD KIT 3651
71942-3 WS RTK TOTAL ASSAY COMPLETE KIT 29370
71943-3 WIDESCREEN RTK PTYR ASSAY COMPLETE KIT 27535
71975-3 KOD XTREME HOT START DNA POLYMERASE 5402
71978-3 ONE STEP RT-PCR MASTER MIX KIT 5369
72014-3 WIDESCREEN HUMAN CVD PANEL 2 21556
72074-3 ANGIOGENIN TOTAL BEAD KIT 3315
72075-3 ANGIOPOIETIN-2 TOTAL BEAD KIT 3315
72076-3 E-CADHERIN TOTAL BEAD KIT 3315
72077-3 ESTROGEN RECEPTOR ALPHA TOTAL BEAD KIT 3315
72078-3 FAS TOTAL BEAD KIT 3315
72079-3 IGFBP-3 TOTAL BEAD KIT 3315
72080-3 PAI-1 TOTAL BEAD KIT 3448
72081-3 PROGESTERONE RECEPTOR TOTAL BEAD KIT 3315
72082-3 TIMP-1 TOTAL BEAD KIT 3315
72083-3 TIMP-2 TOTAL BEAD KIT 3315
72084-3 UPA TOTAL BEAD KIT 3315
72085-3 BREAST CANCER PANEL I, 6 -PLEX 17424
72086-3 BREAST CANCER PANEL II, 5-PLEX 14762
72087-3 BREAST CANCER PANEL III, 4-PLEX 11834
72088-3 WS BREAST CANCER PANEL I COMPLETE KIT 19162
72089-3 WS BREAST CANCER PANEL II COMPLETE KIT 16989
72090-3 WS BREAST CANCER PANEL III COMPLETE KIT 15710
72103-3 PE GLYCOPEPTIDE ENRICHMENT KIT 5251
72137-3 WIDESCREEN HUMAN MMP PANEL 21556
72157-3 BACMAGIC-2 DNA KIT 9664
72158-3 BACMAGIC-2 TRANSFECTION KIT 12415
72164-3 WIDESCREEN RAT TOXICITY PANEL 1 26013
72174-3 WIDESCREEN RAT TOXICITY PANEL 2 26013
72181-3 293-FREE TRANSFECTION REAGENT 4262
72181-4 293-FREE TRANSFECTION REAGENT 19180
72181-5 293-FREE TRANSFECTION REAGENT 34513
72189-3 MAGPREP P-25 PROTEIN A PARTICLES 1823
72189-4 MAGPREP P-25 PROTEIN A PARTICLES 12556
72190-3 MAGPREP P-25 STREPTAVIDIN PARTICLES 5434
72190-4 MAGPREP P-25 STREPTAVIDIN PARTICLES 21501
72198-3 EPITAG STAT3 (PS727) TOTAL BEAD KIT 5119
72199-3 EPITAG RSK2 (PS386) BEAD KIT 5119
72254-3 WIDESCREEN™ SITE-SPECIFIC PHOSPHO-EGFR C 25011
72276-3 WIDESCREEN HUMAN HORMONE PANEL 1 19832
72283-3 WIDESCREEN HUMAN METABOLISM PANEL 1 25363
72290-3 WIDESCREEN HUMAN METABOLISM PANEL 2 24549
72296-3 WIDESCREEN RAT METABOLISM PANEL 1 21133
72307-3 EPITAG RAF1 TOTAL HS BEAD KIT 5119
72350-3 BACMAGIC-3 DNA KIT 8542
72351-3 BACMAGIC-3 TRANSFECTION KIT 11442
869001-10UG FSH, HU. PITUITARY, IODINATION 2006
869001-50UG FSH, HU. PITUITARY, IODINATION 6268
869003-10UG LH, HU. PITUITARY, IODINATION GR. 1488
869003-50UG LH, HU. PITUITARY, IODINATION GR. 5332
869006-100UG TSH, HU. PITUITARY, IODINATION 10847
869006-10UG TSH, HU. PITUITARY, IODINATION 1989
869006-50UG TSH, HU. PITUITARY, IODINATION 6218
869008-100UG GH, HU. PITUITARY, IODINATION GR. 4530
869008-50UG GH, HU. PITUITARY, IODINATION GR. 2491
869019-5ML NORMAL RABBIT SERUM, LYOPHILIZED SOLID 1003
869031-100UG CHORIONIC GONADOTROPIN, IODINATION GR. 1371
869039-25UG PROLACTIN, HUMAN PITUITARY, IODIN. GRADE 13321
869039-5UG PROLACTIN, HUMAN PITUITARY, IODIN. GRADE 4446
AM01-100UG ANTI-FAS (AB-2) MOUSE MAB (DX2) 3569
AM01L-100UG ANTI-FAS (AB-2) MOUSE MAB (DX2) 4124
AM03-100UG ANTI-BAK (AB-1) MOUSE MAB (TC-100) 4124
AM03-20UG ANTI-BAK (AB-1) MOUSE MAB (TC-100) 1390
AM03T-10UG ANTI-BAK (AB-1) MOUSE MAB (TC-100) 1016
AM04-100UG ANTI-BAK (AB-2) MOUSE MAB (TC-102) 4124
AM04-20UG ANTI-BAK (AB-2) MOUSE MAB (TC-102) 1039
AM05-100UG ANTI-BCL-XL (AB-2) MOUSE MAB (2H12) 4124
AM13-100UG ANTI-BAX (AB-2) MOUSE MAB (ID3) 4124
AM29-100UG ANTI-FAS LIGAND (AB-5) MOUSE MAB (8B8) 4066
AM30-100UG ANTI-PARP-1 (AB-2) MOUSE MAB (C-2-10) 6733
AM32-100UG ANTI-BAX (AB-3) MOUSE MAB (2D2) 4066
AM34-100UG ANTI-CASPASE-3 (AB-2) MO MAB (10C1.C9) 4124
AM39-100UG ANTI-CASPASE-3 MO MAB (AM1.4.1-1B) 3057
AM41-1EA DNA LADDER KIT (SUICIDE TRACK) 3424
AM43-100UG ANTI-BCL-2 (AB-4) MOUSE MAB (10C4) 4066
AM44-100UG ANTI-BAX (AB-6) MOUSE MAB (6A7) 4066
AM46-100UG ANTI-CASPASE-8 (AB-3) MOUSE MAB (1-3) 4124
AM46T-10UG ANTI-CASPASE-8 (AB-3) MOUSE MAB (1-3) 1362
AM47-100UG ANTI-CASPASE-9 (AB-2) MOUSE MAB (1-2) 4066
AM47T-10UG ANTI-CASPASE-9 (AB-2) MOUSE MAB (1-2) 936
AM50-100UG ANTI-MCL-1 (AB-1) MOUSE MAB (RC13) 4066
AM52-50UG ANTI-GRANZYME B MOUSE MAB (2C5/F5) 3832
AM53-50UG ANTI-BIM RAT MAB (14A8) 4753
AM56-100UG ANTI-RANK MOUSE MAB (9A725) 4066
AM57-100UG ANTI-RANKL MOUSE MAB (12A668) 4124
AM58-100UG ANTI-BCL-2A (AB-1) MOUSE MAB (100/D5) 4066
AM59-100UG ANTI-BCL-2 (AB-2) MOUSE MAB (8C8) 4066
AM63-100UG ANTI-A20 MOUSE MAB (59A426) 4505
AM65-100UG ANTI-CASPASE-3 (AB-4) MO MAB (AM1.31-11) 4066
AM68-25UL ANTI-PARP-1 (AB-3) MOUSE MAB (F1-23) 3057
AM69-25UG ANTI-BAFF (AB-2) RAT MAB (BUFFY-1) 3057
AM76-100UG ANTI-TBK1 MOUSE MAB (108A429) 4417
AM78-100UG ANTI-DNASE G (AB-1) MOUSE MAB (HG302) 4695
AM80-100UG ANTI-PAR (AB-1) MOUSE MAB (10H) 4680
AM81-100UG ANTI-XIAP (AB-2) MOUSE MAB (117318) 4622
AM82-100UG ANTI-OMI/HTRA2 MOUSE MAB (196C429) 4856
AP1002-100UG ANTI-TRAF1 MOUSE MAB (3D4) 4900
AP1006-100UL ANTI-NRAGE RABBIT PAB 4066
AP1007-100UL ANTI-WWOX (89-107) RABBIT PAB 4095
AP1008-100UL ANTI-WWOX (28-42) RABBIT PAB 4095
AP1009-100UL PD ANTI-WWOX (PTYR33) RABBIT PAB 4095
AP1013-100UL ANTI-CLVD CASPASE-8 (ASP384) MO MAB 4973
AP1014-50UL ANTI-CLEAVED CASPASE-9 (ASP315) RB PAB 3393
AP1016-50UL ANTI-CLVD INTERLEUKIN-1B (ASP116) RB PAB 3393
AP1017-50UL ANTI-CLEAVED LAMIN A (ASP230) RABBIT PAB 3393
AP1018-50UL ANTI-PARG RABBIT PAB 5104
AP1021-50UG ANTI-CYTOKERATIN 18, HUMAN (RABBIT) 2223
AP1022-50UG ANTI-SPI2A RABBIT PAB 3936
AP1025-50UG ANTI-MER RABBIT PAB 2370
AP1029-100UG ANTI-CYTOCHROME C MOUSE MAB (7H8.2C12) 4168
AP1031-50UG ANTI-APOLLON RABBIT PAB 2223
AP1032-50UG ANTI-TSC1 (TUBEROUS SCLEROSIS 1) RB PAB 2311
AP1034-1SET ANTI-ANT MOUSE MAB (5F51BB5AG7) 3182
AP1035-50UG ANTI-CYCLOPHILIN D MO MAB (E11AE12BD4) 3817
AP1036-50UG ANTI-F1F0-ALPHA MOUSE MAB (7H10BD4F9) 3774
AP1037-50UG ANTI-F1F0-BETA MOUSE MAB (3D5AB1) 3774
AP1038-100UG ANTI-APAF-1 MOUSE MAB (94408) 3920
AP1039-50UG ANTI-SLK RABBIT PAB 2311
AP1041-50UG ANTI-PTEN MOUSE MAB (EMD-15E10) 2311
AP1042-50UG ANTI-PTEN MOUSE MAB (EMD-4B8) 2311
AP1043-50UG ANTI-CASPASE-1 MOUSE MAB (14F468) 3174
AP1044-50UG ANTI-CASPASE-1 (31-45) RABBIT PAB 2838
AP1045-50UG ANTI-CAS RABBIT PAB 2311
AP1046-50UG ANTI-CTIP RABBIT PAB 2238
AP1047-50UG ANTI-IKIP1 GOAT PAB 2238
AP1048-50UG ANTI-PARP10 RABBIT PAB 2311
AP1049-50UG ANTI-WASL/N-WASP RABBIT PAB 2311
AP1050-50UL ANTI-BMI1 (1-326) RABBIT PAB 2311
AP1051-50UL ANTI-TNPO1 RABBIT PAB 2165
AP1052-50UL ANTI-APAF-1 RABBIT PAB 2165
AP1054-100UG ANTI-SPHINGOSINE KINASE 2 RABBIT PAB 3883
AP1055-50UG ANTI-BECLIN-1 RABBIT PAB 3291
AP1056-50UG ANTI-CLEAVED BAD (ASP 61) RABBIT PAB 2852
AP1057-50UG ANTI-ANT2 RABBIT PAB 4022
AP1058-50UG ANTI-TOM70 RABBIT PAB 4300
AP1059-50UG ANTI-VDAC RABBIT PAB 4300
AP1062-50UG PHOSPHODETECTANTI-PDH-E1A(PSER293)RABPAB 4300
AP1063-50UG PHOSPHODETECT ANTI-PDH-E1ALPHA (PSER232) 3980
AP1064-50UG PHOSPHODETECT ANTI-PDH-E1ALPHA (PSER 300 3980
AP1065-50UL PDCD4 RABBIT PAB 4170
AP1132-50UG ANTI-TIGAR RABBIT PAB 2852
AP1134-100UG ANTI-SET MOUSE MAB (M1-F5) 5760
AP1135-100UG ANTI-CTNNBL1 MOUSE MAB (5F1) 5760
AP1136-50UL ANTI-IL3 MOUSE PAB 5760
AP1137-100UG ANTI-ADA MOUSE MAB (4G4-1C6) 5760
AP1138-50UG ANTI-ARSA MOUSE PAB 5760
AP1139-100UG ANTI-ARSB MOUSE MAB 5760
AP1140-100UG ANTI-GBA MOUSE MAB (2E2) 5760
AP1141-50UG ANTI-SPINK1 MOUSE MAB (4D4) 5760
AP1142-100UG ANTI-SPINK1 RABBIT PAB 5760
AP1143-100UG ANTI-PTPRE MOUSE MAB (2D10) 5760
AP1144-100UG ANTI-ACP1 MOUSE MAB (4B10) 5760
AP1145-100UG ANTI-IL13RA2 MOUSE MAB (2E10) 5760
AP1146-100UG ANTI-BIK MOUSE MAB (4G12) 3980
AP1147-100UG ANTI-TNFRSF8 MOUSE MAB (2E2) 3980
AP1148-100UG ANTI-DAD1 MOUSE MAB (1F3-A4) 3980
AP1149-100UG ANTI-EPHX1 MOUSE MAB (2E7) 3980
AP1150-100UG ANTI-GCH1 MOUSE MAB (4A12) 3980
AP1151-100UG ANTI-CXCL1 MOUSE MAB (7A11) 3980
AP1152-100UG ANTI-IL1RN MOUSE MAB (M1-B9) 3980
AP1153-100UG ANTI-IL12RB2 MOUSE MAB (2H6) 3980
AP1154-100UG ANTI-KITLG MOUSE MAB (3E10) 3980
AP1155-100UG ANTI-PON1 MOUSE MAB (2H7) 3980
AP1156-100UG ANTI-CCL3 MOUSE MAB (4E7) 3980
AP1157-100UG ANTI-TNFRSF1B RABBIT PAB 3980
AP1158-100UG ANTI-IL1R2 RABBIT PAB 3980
AP1159-100UG ANTI-TNFRSF14 MOUSE MAB (2G6-2C7) 3980
AP1160-100UG ANTI-NDRG1 MOUSE MAB (2D7) 3980
AP1161-100UG ANTI-IL20 MOUSE MAB (2H8) 3980
AP1162-100UG ANTI-NDRG2 MOUSE MAB (6A5) 3980
AP1163-50UG ANTI-TP53BP2 MOUSE MAB (3F8) 3980
AP1164-100UG ANTI-PDCD7 MOUSE MAB (3H5) 3980
AP1165-50UG ANTI-FIS1 MOUSE MAB (1G9) 3980
AP1166-100UG ANTI-NGFRAP1 MOUSE MAB (4E5) 3980
AP1167-100UG ANTI-TNS4 MOUSE MAB (3B8) 3980
AP1168-100UG ANTI-TNFSF14 MOUSE MAB (4E3) 3980
AP1169-100UG ANTI-CCL7 MOUSE MAB (4B5) 3980
AP1170-100UG ANTI-PAFAH1B1 MOUSE MAB (2C12) 3980
AP1171-100UL ANTI-IFNGR1 RABBIT PAB 3980
AP1172-100UG ANTI-MST1R  MOUSE MAB (4E2) 3519
AP1173-100UG ANTI-EPHA4 MOUSE MAB (6H7) 3980
AP1174-100UL ANTI-DLC1 RABBIT PAB 3980
AP1175-100UG ANTI-ING4 RABBIT PAB 3980
AP1176-100UG ANTI-LIPA RABBIT PAB 3519
AP1177-100UG ANTI-LIPA MOUSE MAB (1F9) 3519
AP1178-100UG ANTI-SERPINE2 MOUSE MAB (3G12) 3519
AP1179-100UG ANTI-TLR4 MOUSE MAB (1H7) 3519
AP1180-100UG ANTI-TLR5 MOUSE MAB (4F7) 3519
AP1181-100UG ANTI-TLR7 MOUSE MAB (2C9) 3519
ASK07-1EA P53 ANTIBODY SAMPLER KIT 4651
ASK10-1EA MMP/TIMP FAMILY ANTIBODY SAMPLER KIT I 4929
ASK12-1EA BCL-2 FAMILY ANTIBODY SAMPLER KIT 4856
ASK19-1EA COLLAGEN AB SAMPLER I 3624
ASK20-1EA NF-KAPPAB ANTIBODY SAMPLER KIT 3657
ASK26-1EA MDM2 ANTIBODY SAMPLER KIT-HUMAN 2748
BA24-100UG ANTI-THROMBOSPONDIN (AB-3) MO MAB (A6.1) 4124
BPHCP001-6 WIDESCREEN HUMAN CANCER PANEL 1 - M&M 25165
BPHCP001-AFP 20X AFP CAPTURE BEADS - M&M 0
BPHCP001-BASE WIDESCREENBEADPLEXHUMANCP1-BASE - M&M 0
BPHCP001-CA3 20X CA 15-3 CAPTURE BEADS - M&M 0
BPHCP001-CA5 20X CA-125 CAPTURE BEADS - M&M 0
BPHCP001-CA9 20X CA 19-9 CAPTURE BEADS - M&M 0
BPHCP001-CEA 20X CEA CAPTURE BEADS - M&M 0
BPHCP001-PRO 20X PROLACTIN CAPTURE BEADS - M&M 0
BPHCP002-12 WIDESCREEN BEADPLEX HUMAN CP2 - M&M 40783
BPHCP002-AMP 20X AMPHIREGULIN CAPTURE BEADS - M&M 0
BPHCP002-BASE WIDESCREENBEADPLEXHUMANCP2-BASE - M&M 0
BPHCP002-BTC 20X BETACELLULIN CAPTURE BEADS - M&M 0
BPHCP002-EGF 20X EGF CAPTURE BEADS - M&M 0
BPHCP002-EGR 20X EGF-R CAPTURE BEADS - M&M 0
BPHCP002-EPI 20X EPIREGULIN CAPTURE BEADS - M&M 0
BPHCP002-FGF 20X FGF BASIC CAPTURE BEADS - M&M 0
BPHCP002-HBE 20X HB-EGF CAPTURE BEADS - M&M 0
BPHCP002-PDG 20X PDGF-BB CAPTURE BEADS - M&M 0
BPHCP002-PIG 20X PLGF CAPTURE BEADS - M&M 0
BPHCP002-TEN 20X TENASCIN C CAPTURE BEADS - M&M 0
BPHCP002-TGF 20X TGFALPHA  CAPTURE BEADS - M&M 0
BPHCP002-VEG 20X VEGF CAPTURE BEADS - M&M 0
BPHCVD01-7 WIDESCREEN BEADPLEX HUMAN CVD PANEL1-M&M 27117
BPHCVD01-AAI HUAPOLIPOPROTEINAICAPTUREBEADS(20X)-M&M 0
BPHCVD01-AII HUAPOLIPOPROTEINALLCAPTUREBEADS20X-M&M 0
BPHCVD01-APB HUAPOLIPOPROTEINBCAPTUREBEADS20X-M&M 0
BPHCVD01-APE HUAPOLIPOPROTEINECAPTUREBEADS20X-M&M 0
BPHCVD01-APH HUAPOLIPOPROTEINHCAPTUREBEADS20X-M&M 0
BPHCVD01-APJ HUAPOLIPOPROTEINJCAPTUREBEADS20X-M&M 0
BPHCVD01-BASE WIDESCREENBEADPLEXHUCVDPANEL1-BASE-M&M 0
BPHCVD01-CII HUAPOLIPOPROTEINCIIICAPTUREBEADS20X-M&M 0
BPHCVD01-CLU HUCLUSTERIN/APOJCAPTUREBEADS20X-M&M 2117
BPHCVD02-6 WIDESCREEN BEADPLEX HUMAN CVD PANEL2-M&M 17691
BPHCVD02-IL6 HUMAN IL6 CAPTURE BEADS (20X) - M&M 2117
BPHCVD02-IL8 HUMAN IL8 CAPTURE BEADS (20X) - M&M 2117
BPHCVD02-M1A HUMAN M1A CAPTURE BEADS (20X) - M&M 2117
BPHCVD02-M1B HUMAN M1B CAPTURE BEADS (20X) - M&M 2117
BPHCVD02-MCP HUMAN MCP CAPTURE BEADS (20X) - M&M 2117
BPHCVD02-TNF HUMAN TNF CAPTURE BEADS (20X) - M&M 2117
BPHCVD03-6 WIDESCREEN BEADPLEX HUMAN CVD PANEL3-M&M 25165
BPHCVD03-BASE WIDESCREEN BEADPLEX HUMAN CVDPANEL3-M&M 0
BPHCVD03-ESE 20X HUMAN E-SELECTIN CAPTURE BEADS - M&M 0
BPHCVD03-ICA 20X HUMAN ICAM-1 CAPTURE BEADS - M&M 0
BPHCVD03-LEP 20X HUMAN LEPTIN CAPTURE BEADS - M&M 0
BPHCVD03-OST 20X HUMAN OSTEOPONTIN CAPTURE BEADS -M&M 0
BPHCVD03-PSE 20X HUMAN P-SELECTIN CAPTURE BEADS - M&M 0
BPHCVD03-RAG 20X HUMAN S-RAGE CAPTURE BEADS - M&M 0
BPHCVD04-6 WIDESCREEN BEADPLEX HUMAN CVDPANEL4 -M&M 25165
BPHCVD04-BASE WIDESCREEN BEADPLEX HUMAN CVDPANEL4 -M&M 0
BPHCVD04-BNP 20X HUMAN NT-PRO-BNP CAPTURE BEADS - M&M 0
BPHCVD04-FAB 20X HUMAN FABP CAPTURE BEADS - M&M 0
BPHCVD04-LDL 20X HUMAN MDA-LDL CAPTURE BEADS - M&M 0
BPHCVD04-LOX 20X HUMAN LOX-1 CAPTURE BEADS - M&M 0
BPHCVD04-MYE 20X HUMAN MPO CAPTURE BEADS - M&M 0
BPHCVD04-THR 20XHUMANTHROMBOMODULINCAPTUREBEADS - M&M 0
BPHCVD05-8 WIDESCREEN BEADPLEX HUMAN CVDPANEL5-M&M 29069
BPHCVD05-A2M HUA-2-MACROGLOBULINCAPTUREBEADS(20X)-M&M 0
BPHCVD05-BASE WIDESCREENBEADPLEXHUCVDPANEL5-BASE-M&M 0
BPHCVD05-CRP HUMAN CRP CAPTURE BEADS (20X) - M&M 0
BPHCVD05-FEA HUMAN FETUIN A CAPTURE BEADS (20X) - M&M 0
BPHCVD05-FIB HUMAN FIBRINOGEN CAPTURE BEADS (20X)-M&M 0
BPHCVD05-HAP HUMANHAPTOGLOBINCAPTUREBEADS(20X)-M&M 0
BPHCVD05-LPA HUMAN LP(A) CAPTURE BEADS (20X) - M&M 0
BPHCVD05-SAP HUMAN SAP CAPTURE BEADS (20X) - M&M 0
BPHCVD05-VWF HUMAN VWF CAPTURE BEADS (20X) - M&M 0
BPHCVD06-5 WIDESCREEN BEADPLEX HUMAN CVD PANEL 6 14182
BPHCVD06-ADI HUMAN ADIPONECTIN CAPTURE BEADS (20X) 994
BPHCVD06-BASE WIDESCREENBEADPLEXHUMANCVDPANEL6-BASEKIT 8946
BPHCVD06-CYS HUMAN CYSTATIN C CAPTURE BEADS (20X) 994
BPHCVD06-ENR HUMAN EN-RAGE CAPTURE BEADS (20X) 994
BPHCVD06-PAI HUMAN PAI-1 CAPTURE BEADS (20X) 994
BPHCVD06-VCM HUMAN VCAM-1 CAPTURE BEADS (20X) 994
BPHKT001-CAL HUMAN CALBINDIN CAPTURE BEADS 994
BPHKT001-CLU HUMAN CLUSTERIN/APOJ CAPTURE BEADS (20X) 994
BPHKT001-CTRL1 HUMAN KIDNEY TOXICITY PANEL 1 CONTROL 1 2117
BPHKT001-CTRL2 HUMAN KIDNEY TOXICITY PANEL 1 CONTROL 2 2117
BPHKT001-DABM HUMAN KIDNEY TOXICITY PANEL 1 DETECTION 2117
BPHKT001-GSA HUMAN GST-Α CAPTURE BEADS (20X) 994
BPHKT001-GSP HUMAN GST-Π CAPTURE BEADS (20X) 994
BPHKT001-HCD HUMAN HCD CAPTURE BEADS (20X) 2117
BPHKT001-KIM HUMAN KIM-1 CAPTURE BEADS (20X) 994
BPHKT001-SCF HUMAN SCF CAPTURE BEADS (20X) 994
BPHKT001-STDM HUMAN KIDNEY TOXICITY PANEL1STANDARDSMIX 2117
BPHKT001-TIM HUMAN TIMP-1 CAPTURE BEADS (20X) 994
BPHKT001-VEG HUMAN VEGF CAPTURE BEADS (20X) 994
BPHKT002-B2M HUMANBETA-2-MICROGLOBULINCAPTUREBEADS(20 994
BPHKT002-CTRL1 HUMAN KIDNEY TOXICITY PANEL 2 CONTROL 1 2117
BPHKT002-CTRL2 HUMAN KIDNEY TOXICITY PANEL 2 CONTROL 2 2117
BPHKT002-CYS HUMAN CYSTATIN C CAPTURE BEADS (20X) 994
BPHKT002-DABM HUMANKIDNEYTOXICITYPANEL2DETECTIONANTIBO 1984
BPHKT002-NGA HUMAN NGAL CAPTURE BEADS (20X) 994
BPHKT002-OST HUMAN OSTEOPONTIN CAPTURE BEADS (20X) 994
BPHKT002-STDM HUMAN KIDNEY TOXICITY PANEL 2 STANDARDS 2117
BPHKT002-TIM HUMAN TIMP-1 CAPTURE BEADS (20X) 2117
BPHKT003-ALB HUMAN ALBUMIN CAPTURE BEADS (20X) 994
BPHKT003-CTRL1 HUMAN KIDNEY TOXICITY PANEL 3 CONTROL 1 2117
BPHKT003-CTRL2 HUMAN KIDNEY TOXICITY PANEL 3 CONTROL 2 2117
BPHKT003-DABM HUMAN KIDNEY TOXICITY PANEL 3DETECTIONAB 2117
BPHKT003-STDM HUMAN KIDNEY TOXICITY PANEL3STANDARDSMIX 2117
BPHKT003-TFF HUMAN TFF3  CAPTURE BEADS (20X) 994
BPHKT003-THP HUMAN THP CAPTURE BEADS (20X) 994
BPHM*-6 OXIDATIVE PHOSPHORYLATION PANEL (6-PLEX) 17691
BPHRTK01-10TOT Widescreen® BeadPlex® Human Receptor Tyrosine Kinase Total 10-Plex Panel (Complete-Total kit) 18303
BPMCVD01-5 WIDESCREENBEADPLEXMOUSECVDPANEL1 - M&M 23213
BPMCVD01-BASE WIDESCREENBEADPLEXMOUSECVDPANEL1 - M&M 0
BPMCVD01-CLU 20X MOUSE CLUSTERIN CAPTURE BEADS - M&M 0
BPMCVD01-CRP 20X MOUSE CRP CAPTURE BEADS - M&M 0
BPMCVD01-CYC 20X MOUSE CYSTATIN-C CAPTURE BEADS - M&M 0
BPMCVD01-HGN 20X MOUSE HAPTOGLOBIN CAPTURE BEADS -M&M 0
BPMCVD01-SAP 20X MOUSE SAP CAPTURE BEADS - M&M 0
CA1001-200UL ANTI-BRST-2 MOUSE MAB (D6) 4095
CA1003-200UL ANTI-CA 19-9 MOUSE MAB (116-NS-19-9) 4095
CA1004-200UL ANTI-CA 125 MOUSE MAB (OC 125) 4168
CA1005-200UL ANTI-MEL-5 MOUSE MAB (TA99) 4095
CA1007-10T PD ANTI-RB (PSER780) RABBIT PAB 5017
CA1010-50UL ANTI-PAX3 RABBIT PAB 4329
CA1012-100UG ANTI-PIRH2 RABBIT PAB 4212
CA1012-50UG ANTI-PIRH2 RABBIT PAB 2253
CA1014-50UG ANTI-EPLIN RABBIT PAB 2370
CA1015-50UL ANTI-HSP27 RABBIT PAB 2370
CA1016-50UL ANTI-HSP90A RABBIT PAB 2370
CA1017-50UL ANTI-HSP90B RABBIT PAB 2370
CA1019-50UG ANTI-EPLIN, INTERNAL RABBIT PAB 2370
CA1020-50UG ANTI-LMO1 RABBIT PAB 2267
CA1021-50UG ANTI-BNF1 RABBIT PAB 2223
CA1023-50UG ANTI-HSP90ALPHA MOUSE MAB (EMD-17D7) 2311
CA1024-50UG ANTI-HSP90BETA MOUSE MAB (EMD-5E12) 2311
CA1025-50UG ANTI-HSP27 MOUSE MAB (EMD-35) 2311
CA1026-50UL ANTI-WILM'S TUMOR PROTEIN RABBIT PAB 3393
CA1027-100UG ANTI-ADAMTS4 RABBIT PAB 4724
CA1028-200UL ANTI-C-MYB/V-MYB MOUSE MAB (4E3) 3189
CA1029-50UL ANTI-N-CADHERIN MOUSE MAB (13A9) 2311
CA1030-50UL ANTI-&ALPHA -CATENIN MOUSE MAB (1G5) 2311
CA1031-100UL ANTI-ICMT (170-279) RABBIT PAB 5090
CA1032-300UG ANTI-PINK1 RABBIT PAB 4095
CA1033-100UG ANTI-BRCA2 RABBIT PAB 3540
CA1036-100UG ANTI-CUTL1 MOUSE MAB (2A10) 5760
CA1037-100UG ANTI-NR0B1 RABBIT PAB 5760
CA1038-100UG ANTI-PRDM1 MOUSE MAB (2B10) 5760
CA1039-100UG ANTI-HSPA1B MOUSE MAB (3B7) 5760
CA1040-100UG ANTI-SHBG MOUSE MAB (5E6) 5760
CA1041-100UG ANTI-DNAJB2 MOUSE MAB (2C9) 3980
CA1042-100UG ANTI-HSPA1L RABBIT PAB 3980
CA1043-100UG ANTI-HSPA9 RABBIT PAB 3980
CA1044-100UG ANTI-HSPB8 MOUSE MAB (5B12) 3519
CA1045-100UG ANTI-PRLR RABBIT PAB 3519
CA1046-100UG ANTI-PRLR MOUSE MAB (1E4) 3519
CB1000-10T PD ANTI-CORTACTIN (PTYR421) RABBIT PAB 5017
CB1001-500UG ANTI-GAPDH MOUSE MAB (6C5) 4168
CB1003-100UG ANTI-CENTROSOME MOUSE MAB (6C6) 4183
CB1004-50UG ANTI-CAVEOLIN-2 RABBIT PAB 4724
CB1005-50UG PD ANTI-CAVEOLIN-2 (PSER23) RABBIT PAB 4943
CB1006-50UG PD ANTI-CAVEOLIN-2 (PSER36) RABBIT PAB 4943
CB1007-50UL ANTI-GROEL MOUSE MAB (9A1/2) 3657
CB1012-50UG ANTI-P19ARF (54-75) RAT MAB (5-C3-1) 2223
CB1013-50UG ANTI-P19ARF (54-75) RAT MAB (12-A1-1) 2223
CB1014-500UL ANTI-CD68 MOUSE MAB (KP1) 4066
CB1016-50UL ANTI-PAXILLIN MOUSE MAB (M107) 3335
CB1017-50UG ANTI-MMP3 MOUSE MAB (SPM293) 4388
CB1018-50UG EMI-1 RABBIT PAB 4170
CB1020-100UG ANTI-MFN2 MOUSE MAB (4H8) 5760
CB1021-100UG ANTI-GMNN MOUSE MAB (1A8) 5760
CB1022-100UG ANTI-S100A9 RABBIT PAB 5760
CB1023-100UG ANTI-S100A9 MOUSE MAB (1C10) 5760
CB1024-100UG ANTI-ACTN4 MOUSE MAB (4D10) 5760
CB1025-100UG ANTI-ADD1 MOUSE MAB (2C9) 5760
CB1026-50UG ANTI-PDZK1 MOUSE MAB (1C3-2B11) 5760
CB1027-100UG ANTI-TNNT2 MOUSE MAB (3H4-F7) 5760
CB1028-100UG ANTI-MAP1LC3B MOUSE MAB (4E11) 5760
CB1029-100UG ANTI-HAMP MOUSE MAB (1F9) 5760
CB1030-100UG ANTI-INHBA RABBIT PAB 5760
CB1031-100UG ANTI-GHRL MOUSE MAB (2F4) 5760
CB1032-100UG ANTI-MYL6 MOUSE MAB (1D6) 3980
CB1033-100UG ANTI-CD83 MOUSE MAB (3G10-1F4) 3980
CB1034-100UG ANTI-CEACAM1 MOUSE MAB (2F10) 3980
CB1035-100UG ANTI-CD82 MOUSE MAB (4F2) 3980
CB1036-100UG ANTI-S100A7 MOUSE MAB (1A4) 3980
CB1037-100UL ANTI-S100A7 RABBIT PAB 3980
CB1038-100UG ANTI-S100A10 MOUSE MAB (4D2-F1) 3980
CB1039-100UG ANTI-S100A4 MOUSE MAB (1F12-1G7) 3980
CB1040-100UG ANTI-S100B MOUSE MAB (1B2) 3980
CB1041-50UG ANTI-RDX MOUSE MAB (1E12) 3519
CB1042-100UG ANTI-GSN MOUSE MAB (3G5) 3980
CB1043-100UG ANTI-GSN RABBIT PAB 3980
CB1044-100UG ANTI-OCLN MOUSE MAB (1G7) 3980
CB1045-100UG ANTI-OCLN RABBIT PAB 3980
CB1046-100UG ANTI-CLDN1 MOUSE MAB (1C5-D9) 3980
CB1047-100UG ANTI-STMN1 RABBIT PAB 3980
CB1048-100UG ANTI-TNNI2 RABBIT PAB 3980
CB1049-100UG ANTI-CD99 RABBIT PAB 3519
CB1050-100UG ANTI-CD99 MOUSE MAB (3A10) 3519
CB1051-50UG ANTI-AMELX MOUSE MAB (3B5) 3519
CB1052-100UG ANTI-TUBB2A MOUSE MAB (2B2) 3519
CBA001-1KIT INNOZYME CATHEPSIN B ACTIVITY ASSAY KIT 6250
CBA003-1KIT INNOZYMEGELATINASE(MMP2/MMP9)ACTIVITYKIT 7120
CBA004-1KIT PD AKT (PTHR308) ELISA KIT 11644
CBA005-1KIT PD AKT (PSER473) ELISA KIT 11644
CBA006-1KIT PD ERK1/2 (PTHR185/PTYR187) ELISA KIT 10879
CBA008-1KIT PD P38 MAPK (PTHR180/PTYR182) ELISA KIT 11644
CBA009-1KIT P53, PHOSPHO-SPECIFIC (SER15) ELISA KIT 11644
CBA010-1KIT INNOCYTE CELL MIGRATION ASSAY, 96-WELL 5760
CBA011-1KIT IC ECM CELL ADHESION ASSAY, FIBRONECTIN 3230
CBA012-1KIT IC ECM CELL ADHESION ASSAY, VITRONECTIN 7615
CBA013-1KIT IC ECM CELL ADHESION ASSAY, COLLAGEN IV 4080
CBA016-1KIT HUMAN NEUTROPHIL ELASTASE ACTIVITY KIT 8031
CBA017-1KIT INNOCYTE CELL MIGRATION ASSAY, 24-WELL 5760
CBA018-1KIT EGF-R ELISA KIT 8991
CBA019-1KIT K-LISA AKT ACTIVITY KIT 7245
CBA020-1KIT K-LISA CHECKPOINT ACTIVITY KIT 7709
CBA023-1KIT INNOZYME CATHEPSIN L ACTIVITY KIT 7245
CBA024-1KIT INNOZYME MYELOPEROXIDASE ACTIVITY KIT 7822
CBA025-1KIT IC ECM CELL ADHESION ASSAY, LAMININ/BMC 5664
CBA026-1KIT IC ECM CELL ADHESION ASSAY, GALECTIN1/3 6050
CBA029-1KIT P38 MAP KINASE ELISA KIT 11644
CBA031-1KIT C-MET ELISA KIT 10879
CBA032-1KIT ERK 1/2 ELISA KIT 11644
CBA033-1KIT JNK 1/2 ELISA KIT 11644
CBA037-1KIT INNOCYTE A2, A3, A5 INTEGRIN DETECT. KIT 7001
CBA038-1KIT PD INSULIN REC (PTYR1162/1163) ELISA KIT 10879
CBA039-1KIT INSULIN RECEPTOR (BETA) ELISA KIT 10879
CBA040-1KIT APO-BRDU KIT 8930
CBA041-1KIT APO-DIRECT KIT 10732
CBA042-1KIT INNOZYME TACE ACTIVITY KIT 8433
CBA043-1KIT IC LAMININ-BASED CELL INVASION ASSAY 7637
CBA044-1KIT K-LISA IKKBETA INHIBITOR SCREENING KIT 7268
CBA045-1KIT ACTIVE CASPASE-3 ELISA KIT 10479
CBA046-1KIT ACTIVE CASPASE-8 ASSAY KIT 7209
CBA048-1KIT SURVIVIN ELISA KIT 10479
CBA049-1KIT XIAP ELISA KIT 10479
CBA051-1KIT K-LISA AURORA KINASE ACTIVITY KIT 7393
CBA053-1KIT COX-2 ELISA KIT 9943
CBA054-1KIT INNOZYME CALPAIN1/2 ACTIVITY ASSAY KIT 7170
CBA055-1KIT K-LISA MTOR ACTIVITY KIT 9022
CBA057-1KIT HSP90ALPHA ELISA KIT 9354
CBA059-1KIT ANNEXIN V-FITC APOPTOSIS DET. KIT II 3094
CBA060-100TEST ANNEXIN V-PE APOPTOSIS DETECTION KIT 6390
CBA060-25TEST ANNEXIN V-PE APOPTOSIS DETECTION KIT 4501
CBA062-1KIT PHOSPHODETECT FAK (PTYR397) ELISA KIT 10496
CBA064-1KIT IKAPPABALPHA ELISA KIT 10830
CBA065-1KIT PD IKAPPABALPHA (PSER32) ELISA KIT 11664
CBA066-1KIT PRAS40 ELISA KIT 11644
CBA069-1KIT PD GSK-3BETA (PSER9) ELISA KIT 10496
CBA071-1KIT CREB ELISA KIT 10879
CBA072-1KIT PHOSPHODETECT CREB (PSER133) ELISA KIT 10879
CBA073-1KIT PD C-MET (PTYR1230/1234/1235) ELISA KIT 10496
CBA077-1KIT INNOCYTE CYTOCHROME C RELEASE KIT 5548
CBA078-1KIT PHOSPHODETECT HSP27 (PSER 78/82) ELISA K 8748
CBA079-1KIT INNOZYME INSULYSIN/IDE IMMUNOCAPTURE ACT 9594
CBA083-1KIT INNOCYTE ECM CELL ADHESION ARRAY 9724
CBA085-1KIT INNOZYME DPP IV IMMUNOCAPTURE ASSAY 14135
CBA086-1KIT GLUCOSE ASSAY KIT 5597
CBA087-1KIT UBIQUITIN-CONJUGATING (UBC) E2 ENZYME AC 7939
CBA095-1KIT INNOZYME PR3 IMMUNOCAPTURE ACTIVITYASSAY 9770
CBA096-1KIT METHYLTRANSFERASE ASSAY 10088
CBA097-1KIT INNOZYME DPP IV ACTIVITY ASSAY KIT 9724
CBA098-1KIT INNOCYTE MONOCYTE CELL MIGRATION ASSAY 5850
CBA099-1KIT K-LISA PDK2 ACTIVITY KIT 6602
CBA100-1KIT 20S PROTEOSOME ELISA KIT 7441
CBA101-1KIT PHOSPHOINOSITIDE 3 KINASE ASSAY KIT 5450
CBA102-1KIT SPHINGOSINE KINASE ASSAY KIT 5450
CBA104-1KIT K-LISA MTOR (RECOMBINANT) ACTIVITY KIT 12535
CBA106-1KIT HUMAN WWP1 CHEMILUMINESCENT ELISA KIT 8107
CBA107-1KIT HUMAN PRO-ISG15 ELISA KIT 7308
CC01-100UG ANTI-CDC2/CDK1 (AB-2) MOUSE MAB (CDC2.1) 2530
CC02-100UG ANTI-CYCLIN A (AB-2) MOUSE MAB (BF683) 3057
CC03-100UG ANTI-CYCLIN B1 (AB-2) MOUSE MAB (2H1-H6) 3057
CC04-100UG ANTI-CYCLIN D1 (AB-1) RAT MAB (17A6-4) 3057
CC12-100UG ANTI-CYCLIN D1 (AB-3) MOUSE MAB (DCS-6) 3101
CC12F-100UG ANTI-CYCLIN D1 MO MAB (DCS-6) FITC CONJ 4592
CC13-100UG ANTI-CYCLIN D3 (AB-2) MOUSE MAB (DCS-22) 3057
CC16-100UG ANTI-CDC2/CDK1 (AB-3) MO MAB (A17.1.1) 2530
CC17-100UG ANTI-CYCLIN A (AB-3) MOUSE MAB (E23) 3057
CC19L-100UG ANTI-CDK4 (AB-2) MOUSE MAB (DCS32.1) 2530
CC25-100UG ANTI-CDC25B (AB-1) MOUSE MAB (DCS.162.2) 2530
CC30-100UG ANTI-CDC6 (AB-3) MOUSE MAB (DCS 180.3) 3680
CC43-100UG ANTI-CDH1 (AB-2) MOUSE MAB (DH01) 4124
CC44-100UG ANTI-CHK2 (AB-2) MOUSE MAB (2CHK01) 4066
CL07-1000ML TMB (SOLUBLE SUBSTRATE) 5583
CL07-100ML TMB (SOLUBLE SUBSTRATE) 920
CLM1510EMD GLYCEROL (13C3, 99%) 35150
CP01-1EA ANTI-ACTIN (AB-1) MOUSE MAB (JLA20) 3949
CP06-100UG ANTI-A-TUBULIN MOUSE MAB (DM1A) 4388
CP07-200UG ANTI-B-TUBULIN MOUSE MAB (DM1B) 5999
CP09-100UG ANTI-GAP-43 MOUSE MAB (5E7) 4066
CP09L-100UG ANTI-GAP-43 MOUSE MAB (5E7) 4066
CP11L-100UG ANTI-INTEGRIN A3 MOUSE MAB (P1B5) 4066
CP12L-100UG ANTI-INTEGRIN A5/FNR MOUSE MAB (P1D6) 4066
CP13L-100UG ANTI-FIBRONECTIN (AB-1) MO MAB (N-294) 4066
CP17-100UG ANTI-COLLAGEN TYPE I MO MAB (I-8H5) 4124
CP17-20UG ANTI-COLLAGEN TYPE I MO MAB (I-8H5) 1039
CP18-100UG ANTI-COLLAGEN, TYPE II (AB-1) MOUSE MAB 4066
CP19-100UG ANTI-COLLAGEN TYPE III MO MAB (III-53) 4066
CP19-20UG ANTI-COLLAGEN TYPE III MO MAB (III-53) 1024
CP20-100UG ANTI-COLLAGEN TYPE IV MO MAB (IV-4H12) 4066
CP26-100UG ANTI-INTEGRIN B1 MOUSE MAB (4B7) 4066
CP28-200UG ANTI-FIBROBLAST ANTIGEN MOUSE MAB (AS02) 9923
CP33-100UL ANTI-B1-SPECTRIN MOUSE MAB (4C3) 4402
CP34-100UG ANTI-PROHIBITIN MOUSE MAB (II-14-10) 5401
CP35-100UL ANTI-PSD-95 (AB-2) MOUSE MAB (7E3-1B8) 5982
CP43-100UL ANTI-ENDOTHELIN (AB-1) MOUSE MAB (3B8C9) 4402
CP44-100UL ANTI-ENDOTHELIN-1 MO MAB (TR.ET.48.5) 5018
CP45-100UL ANTI-CLATHRIN HEAVY CHAIN MO MAB (X22) 4461
CP46-100UL ANTI-A-ADAPTIN (AP2) MOUSE MAB (AP.6) 4402
CP53-100UG ANTI-ICAM-1 (AB-2) MOUSE MAB (W-CAM-1) 4801
CP56-500UL ANTI-COLLAGEN, TYPE IV (AB-2) MOUSE MAB 4066
CP58-100UG ANTI-PAXILLIN MOUSE MAB (5H11) 4066
CP63-100UG ANTI-EPCAM (AB-1) MOUSE MAB (1DG.F3) 4066
CP64-100UL ANTI-ACTIN (AB-3) MOUSE MAB (HHF-35) 3276
CP70-100UG ANTI-FIBRONECTIN (AB-3) MO MAB (FBN11) 4124
CP74-100UG ANTI-VINCULIN MOUSE MAB (V284 OR VLN01) 4066
DC01L-200UG ANTI-RAT IGG (GOAT) PEROXIDASE CONJUGATE 1484
DC02L-200UG GOAT ANTI-MOUSE IGG PEROXIDASE CONJUGATE 1024
DC03L-200UG GOAT ANTI-RABBIT IGG PEROXIDASE CONJ. 1172
DC05L-200UG GOAT ANTI-MOUSE IGG AP CONJUGATE 995
DC06L-200UG GOAT ANTI-RABBIT IGG AP CONJUGATE 995
DC08L-200UG GOAT ANTI-MOUSE TOTAL IG PEROXIDASE CONJ 1484
DC13L-100UG GOAT ANTI-MOUSE IGG FITC CONJUGATE 1054
DC15L-100UG GOAT ANTI-RABBIT IGG FITC CONJUGATE 1054
DC18L-100UG ANTI-MOUSE IGG (GOAT)TEXAS RED CONJUGATE 995
DC20L-100UG GOAT ANTI-RABBIT IGG TEXAS RED CONJ. 995
DP01-100UG ANTI-SV40 T ANTIGEN MO MAB (PAB419) 4124
DP01L-100UG ANTI-SV40 T ANTIGEN MO MAB (PAB419) 4066
DP02-200UG ANTI-SV40 T ANTIGEN MO MAB (PAB416) 4300
DP02A-0.5ML ANTI-SV40 T AG MO MAB (PAB416) AGAR CONJ 5338
DP08-100UG ANTI-ADENOVIRUS 5 E1B RT MAB (9C10) 4066
DP10L-100UG ANTI-POLYOMA VIRUS T ANTIGEN MO MAB (F4) 4066
DP11-100UG ANTI-ADENOVIRUS 2 E1A MOUSE MAB (M73) 4124
DP12-100UG ANTI-HPV 18/16-E6 MOUSE MAB (C1P5) 4124
DP12L-100UG ANTI-HPV 18/16-E6 MOUSE MAB (C1P5) 4066
DP14L-100UG ANTI-SV40 T ANTIGEN MO MAB (PAB280) 4066
DP15L-100UG ANTI-EBNA MOUSE MAB (E8.26) 4066
DP16-100UG ANTI-ADENOVIRUS 2 E1B MO MAB (IF8) 4066
DP17-100UG ANTI-ADENOVIRUS 2 E1B MO MAB (3D11) 4066
DR1001-100UL ANTI-8-HYDROXYGUANOSINE GOAT PAB 3993
DR1002-50UG PD ANTI-ATM (PSER1981)MO MAB (10H11.E12) 2647
DR1003-50UL ANTI-P53 BINDING PROTEIN 1 MO MAB (BP13) 2428
DR1006-100UL ANTI-CLASPIN RABBIT PAB 4900
DR1008-100UL ANTI-MCM3 GOAT PAB 4900
DR1009-100UL ANTI-MCM4 GOAT PAB 4900
DR1010-100UL ANTI-MCM6 GOAT PAB 4900
DR1014-50UG ANTI-HAUSP RABBIT PAB 2399
DR1015-100UG ANTI-RENT1 GOAT PAB 4900
DR1016-100UG ANTI-H2AX RABBIT PAB 4680
DR1017-100UG PD ANTI-H2AX (PSER139) RABBIT PAB 4973
DR1018-100UG ANTI-NFBD1/MDC1 RABBIT PAB 4622
DR1019-100UG ANTI-MAFA RABBIT PAB 4900
DR1021-100UG ANTI-C-MAF RABBIT PAB 4900
DR1022-50UG ANTI-PSO4 RABBIT PAB 2370
DR1023-50UL PD ANTI-P53 (PSER20) RABBIT PAB 2881
DR1024-50UL PD ANTI-P53 (PSER46) RABBIT PAB 2881
DR1025-50UL PD ANTI-CHK1 (PSER317) RABBIT PAB 2881
DR1026-50UL PD ANTI-CHK2 (PTHR68) RABBIT PAB 4715
DR1027-50UL PD ANTI-MDM2 (PSER166) RABBIT PAB 2881
DR1028-100UG ANTI-PARC/H7-AP1 RABBIT PAB 4666
DR1030-50UG ANTI-SMC5 RABBIT PAB 2370
DR1031-50UG ANTI-SMC6 RABBIT PAB 2370
DR1032-50UG ANTI-WRN RABBIT PAB 2370
DR1033-50UG ANTI-NBS1 RABBIT PAB 2370
DR1034-50UG ANTI-BLM RABBIT PAB 2666
DR1035-50UG ANTI-SMG1 RABBIT PAB 2311
DR1036-50UL ANTI-CHK2 RABBIT PAB 2311
DR1037-50UG ANTI-PLK1 MOUSE MAB (35-206) 2311
DR1038-100UL ANTI-NEIL1 RABBIT PAB 3980
DR1039-50UG ANTI-ORC1 RABBIT PAB 2238
DR1040-50UL ANTI-PARC (1-763) RABBIT PAB 2311
DR1041-50UL ANTI-TIP60 RABBIT PAB 2311
DR1042-100UG ANTI-APEX1 MOUSE MAB (4D1) 5760
DR1043-100UG ANTI-FEN1 RABBIT PAB 5760
DR1044-200UL ANTI-FEN1 MOUSE MAB (1E2) 5760
DR1045-100UG ANTI-GCLC MOUSE MAB (3H1) 5760
DR1046-50UG ANTI-SIAH1 MOUSE MAB (2F2) 5760
DR1047-100UG ANTI-UHRF1 MOUSE MAB (3A11) 5760
DR1048-100UL ANTI-ESRRG RABBIT PAB 5760
DR1049-100UG ANTI-GABPA MOUSE MAB (4B8-G6) 5760
DR1050-100UG ANTI-NFE2L2 MOUSE MAB (1F3) 5760
DR1051-100UG ANTI-NR1H2 MOUSE MAB (2H2-H3) 5760
DR1052-100UG ANTI-SALL4 MOUSE MAB (6E3) 5760
DR1053-100UG ANTI-TCF2 MOUSE MAB (3H4) 5760
DR1054-100UG ANTI-EIF2S1 RABBIT PAB 5760
DR1055-100UG ANTI-EIF2S1 MOUSE MAB (3H12-C11) 5760
DR1056-50UG ANTI-SQSTM1 MOUSE PAB 5760
DR1057-100UG ANTI-SQSTM1 MOUSE MAB 5760
DR1058-100UG ANTI-SOCS3 MOUSE MAB (1E4) 5760
DR1059-100UG ANTI-NSEP1 MOUSE MAB (4F12) 5760
DR1060-100UG ANTI-ELF3 MOUSE MAB (1D8) 3980
DR1061-100UG ANTI-ENO1 MOUSE MAB (8G8) 3980
DR1062-100UG ANTI-ERCC2 RABBIT PAB 3980
DR1063-100UG ANTI-EWSR1 MOUSE MAB (5C10) 3980
DR1064-100UG ANTI-EXT2 MOUSE MAB (3G6) 3980
DR1065-100UG ANTI-GPT RABBIT PAB 3980
DR1066-100UL ANTI-GTF2I RABBIT PAB 3980
DR1067-100UG ANTI-GTF2I MOUSE MAB (3E2) 3980
DR1068-100UG ANTI-HPRT1 MOUSE MAB (4C3-G8) 3980
DR1069-100UL ANTI-POLB RABBIT PAB 3980
DR1070-100UG ANTI-RARB MOUSE MAB (1F7) 3980
DR1071-100UG ANTI-TFAM RABBIT PAB 3980
DR1072-100UG ANTI-XPC MOUSE MAB (6D11) 3980
DR1073-100UG ANTI-HMGA2 MOUSE MAB (2D10) 3980
DR1074-100UG ANTI-GSTO1 RABBIT PAB 3980
DR1075-100UG ANTI-TARDBP MOUSE MAB (2E2-D3) 3980
DR1076-100UG ANTI-GSTO2 RABBIT PAB 3980
DR1077-100UG ANTI-ARX MOUSE MAB (4H8) 3980
DR1078-100UG ANTI-CCL11 MOUSE MAB (1C8-2C1) 3980
DR1079-100UG ANTI-ERCC1 MOUSE MAB (3A7) 3980
DR1080-100UG ANTI-MCM2 MOUSE MAB (6A8) 3519
DR1081-100UG ANTI-SMARCB1 MOUSE MAB (3E10) 3980
DR1082-100UG ANTI-SMARCB1 RABBIT PAB 3980
DR1083-100UG ANTI-GCLM MOUSE MAB (2B8) 3980
DR1084-100UL ANTI-GCLM RABBIT PAB 3980
DR1085-100UG ANTI-LIG4 MOUSE MAB (2D2) 3980
DR1086-100UG ANTI-ATF3 MOUSE MAB (6B8) 3980
DR1087-100UG ANTI-TWIST1 MOUSE MAB (3E11) 3980
DR1088-100UG ANTI-TWIST1 RABBIT PAB 3980
DR1089-100UG ANTI-NKX2-5 MOUSE MAB (1E4-G5) 3980
DR1090-100UG ANTI-AHR MOUSE MAB (3B12) 3980
DR1091-100UG ANTI-GATA2 MOUSE MAB (2D11) 3519
DR1092-100UG ANTI-GATA2 RABBIT PAB 3980
DR1093-100UG ANTI-ETV6 MOUSE MAB (3B10) 3980
DR1094-100UG ANTI-PAX7 MOUSE MAB (1E12) 3980
DR1095-100UG ANTI-E2F2 RABBIT PAB 3980
DR1096-100UG ANTI-MEF2C RABBIT PAB 3980
DR1097-100UG ANTI-RPS3 MOUSE MAB (2A8) 3980
DR1098-100UG ANTI-ID1 MOUSE MAB (1F7) 3980
DR1099-100UG ANTI-PIAS3 MOUSE MAB (4F12) 3519
DR1100-100UG ANTI-ITGB3BP MOUSE MAB (3F6) 3980
DR1101-100UL ANTI-GTF2H3 RABBIT PAB 3519
DR1102-100UG ANTI-XPA RABBIT PAB 3519
DR1103-100UG ANTI-XRCC1 RABBIT PAB 3519
DR1104-100UL ANTI-SMC3 RABBIT PAB 3519
DR1105-100UG ANTI-CRY1 MOUSE MAB (4H4-1C4) 3519
DR1106-100UG ANTI-MSH6 MOUSE MAB (1F2) 3519
DR1107-100UG ANTI-XRCC3 RABBIT PAB 3519
DR1108-100UG ANTI-POLI MOUSE MAB (8G9) 3519
DR1109-100UG ANTI-POLK MOUSE MAB (6F2) 3519
DR1110-100UG ANTI-POLD4 MOUSE MAB (2C11) 3519
DR1111-100UG ANTI-GATA1 RABBIT PAB 3519
DR1112-100UG ANTI-GATA1 MOUSE MAB (3G6) 3519
DR1113-100UG ANTI-NMI RABBIT PAB 3519
DR1114-100UG ANTI-NMI MOUSE MAB (9D8) 3519
DR1115-100UL ANTI-RUNX3 RABBIT PAB 3519
DR1116-100UL ANTI-CEBPG RABBIT PAB 3519
DR1117-100UG ANTI-CEBPG MOUSE MAB (3A3-1A6) 3519
DR1118-100UG ANTI-DMRT1 MOUSE MAB (1G11) 3519
DR1119-100UG ANTI-SIX1 MOUSE MAB (3C7) 3519
DR1120-100UG ANTI-TBX5 RABBIT PAB 3519
DR1121-100UG ANTI-TBX5 MOUSE MAB (1G10) 3519
DR1122-100UG ANTI-KLF10 MOUSE MAB (4G9) 3519
DR1123-100UG ANTI-GCM1 MOUSE MAB (2E11) 3519
DR1124-100UG ANTI-SP7 MOUSE MAB (2G6) 3519
DR1125-100UG ANTI-WARS RABBIT PAB 3519
DR1126-100UG ANTI-WARS MOUSE MAB (3A12) 3519
GF01-200UG ANTI-EGF (AB-1) MOUSE MAB (144-8) 4066
GF05-200UG ANTI-GCSF (AB-1) MOUSE MAB (5.24) 4124
GF06-100UG ANTI-TGF-A (AB-1) MOUSE MAB (134A-2B3) 3057
GF1000-10T PD ANTI-IR (PTYR972) RABBIT PAB 5017
GF1001-10T PD ANTI-IRS-1 (PSER616) RABBIT PAB 5017
GF1003-10T PD ANTI-IRS-1 (PTYR896) RABBIT PAB 5017
GF1005-100UG PD ANTI-IRS-1 (PSER307) RABBIT PAB 4900
GF10-100UG ANTI-TGF-A (AB-2) MOUSE MAB (213-4.4) 3101
GF13L-100UG ANTI-GMCSF (AB-1) MOUSE MAB (GM4.1.9) 4066
GF15-100UG ANTI-TGF-A (AB-3) MO MAB (189-2130.1) 3057
GF15L-100UG ANTI-TGF-A (AB-3) MO MAB (189-2130.1) 4446
GF16-200UG ANTI-TGF-B3 (AB-1) MOUSE MAB (236-5.2) 3057
GF22L-200UG ANTI-BFGF (AB-3) MOUSE MAB (3H3) 6406
GF25-100UG ANTI-VEGF (AB-3) MOUSE MAB (14-124) 4124
GF31-100UG ANTI-TNF-A (AB-1) MO MAB (1825.121) 3101
GF33L-100UG ANTI-TGF-B1 (AB-1) MOUSE MAB (9016.2) 3596
GF35L-100UG ANTI-BDNF MOUSE MAB (35928.11) 3306
GF39-100UG ANTI-HGF MO MAB (4C12.1) 4066
GF40-100UG ANTI-TP MOUSE MAB (P-GF.44C) 4066
GF41-100UG ANTI-VEGF (AB-5) MOUSE MAB (JH121) 4801
GF46-50UG ANTI-VEGF (AB-6) MOUSE MAB (VG76E) 4066
GF47-100UG ANTI-ANGIOSTATIN MO MAB (ANGIO53 1-188) 4066
GF53-100UG ANTI-TPA (AB-1) MOUSE MAB (GMA-043) 3057
GF54-100UG ANTI-FACTVIII REL AG/VWF MO MAB(GMA-022) 2443
GF57-100UG ANTI-ENDOSTATIN (AB-5) MO MAB (NE1.479) 4066
GF59-100UG ANTI-PTH RECEPTOR TYPE 1 MO MAB (3D1.1) 4066
GF60-500UG ANTI-IGFBP-3 MOUSE MAB (84728.111) 4929
GR01-100UG ANTI-EGF-R (AB-1) MOUSE MAB (528) 4124
GR01L-100UG ANTI-EGF-R (AB-1) MOUSE MAB (528) 4124
GR02L-100UG ANTI-EGF-R (AB-2) MOUSE MAB (455) 4066
GR05-100UG ANTI-IR (AB-1) MOUSE MAB (CII 25.3) 4066
GR07-100UG ANTI-IR (AB-3) MOUSE MAB (29B4) 4124
GR08L-100UG ANTI-TR (AB-1) MOUSE MAB (T56/14) 4124
GR09L-100UG ANTI-TR (AB-2) MOUSE MAB (42/6) 4066
GR10-100UG ANTI-NGF-R MOUSE MAB (192) 4066
GR11-100UG ANTI-IGF-I RECEPTOR (AB-1) MO MAB (AIR3) 4241
GR11L-100UG ANTI-IGF-I RECEPTOR (AB-1) MO MAB (AIR3) 4519
GR11T-10UG ANTI-IGF-I RECEPTOR (AB-1) MO MAB (AIR3) 1024
GR12L-100UG ANTI-CSF-1 RECPTR/C-FMS RT MAB(3-4A4-E4) 4066
GR13-100UG ANTI-EGF-R (AB-3) MOUSE MAB (225) 4066
GR13L-100UG ANTI-EGF-R (AB-3) MOUSE MAB (225) 4388
GR15-100UG ANTI-EGFR (AB-5) MOUSE MAB (EGFR.1) 4124
GR15L-100UG ANTI-EGFR (AB-5) MOUSE MAB (EGFR.1) 4066
GR17-100UG ANTI-ER (AB-1) MOUSE MAB (TE-111) 3700
GR18-100UG ANTI-PR (AB-1) MOUSE MAB (PR4-12) 3642
GR21-100UG ANTI-FGFR (AB-1) MOUSE MAB (VBS-7) 4446
GR28L-100UG ANTI-TNFR(AB-1) MOUSE MAB (16803.1) 3057
GR31L-100UG ANTI-IGF-IR (AB-3) MOUSE MAB (33255.111) 3569
GR32L-100UG ANTI-GLUCOCORTICOID RECPTR MO MAB(BUGR2) 4953
GR36-100UG ANTI-IR (B-SUBUNIT) MOUSE MAB (CT-3) 4640
GR37-100UG ANTI-VITAMIN D RECPTR RT MAB (9A7GE10.4) 4801
GR38-100UG ANTI-IGF-I RECEPTOR MO MAB (24-31) 4066
GR39-100UL ANTI-ER B (AB-2) MOUSE MAB (9.88) 3306
GR40-100UG ANTI-ER B (AB-3) MOUSE MAB (10.76) 4066
GR41-50UG ANTI-EDG-3 (AB-1) MOUSE MAB 4066
GR45-100UG ANTI-IRS-1 MOUSE MAB (8-36) 4066
GR47-100UL ANTI-PROGEST RECPTR (PS190) MO MAB(1154) 5075
HC08-8ML FL MOUNTING MEDIA 920
HCS30-1EA BRDU IMMUNOHISTOCHEMISTRY SYSTEM 6803
HSP01-100UG ANTI-HSP72/73 (AB-1) MOUSE MAB (W27) 4066
HTS01-1000TEST BRDU CELL PROLIFERATION ASSAY, HTS 8835
HTS01-200TEST BRDU CELL PROLIFERATION ASSAY, HTS 4316
IF01-100UG ANTI-VIMENTIN/LN6 (AB-1) MOUSE MAB (V-9) 4124
IF02L-100UG ANTI-DESMIN (AB-1) MOUSE MAB (DE-B-5) 4066
IF03L-100UG ANTI-GFAP MOUSE MAB (G-A-5) 3876
IF10-100UG ANTI-LAMININ MOUSE MAB (HL-4H3) 4066
IF14-100UG ANTI-CYTOKERATIN 18 (AB-2) MO MAB (DC10) 4066
IF15-100UG ANTI-CYTOKERATIN 19 MO MAB (A53-B/A2.26) 4066
IM03-100UG ANTI-CATHEPSIN D (AB-1) MO MAB (BC011) 4124
IM09L-100UG ANTI-MMP-9 (AB-1) MOUSE MAB (6-6B) 4124
IM1000-100UG ANTI-PROEPITHELIN RABBIT PAB 4666
IM1001-100UG ANTI-SLPI RABBIT PAB 4724
IM1004-250UL ANTI-DIPEPTIDYLPEPTIDASE IV RABBIT PAB 4724
IM1007-50UG ANTI-LPP3, C-TERMINAL RABBIT PAB 3496
IM1010-50UL ANTI-CD146/MUC18 (AA98) MOUSE MAB (2A5) 2253
IM1011-50UG ANTI-GBP-1 RAT MAB (1B1) 2662
IM1012-50UG ANTI-MTA3 RABBIT PAB 2399
IM1013-50UL ANTI-MMP-12 (AB-2) RABBIT PAB 2354
IM1014-50UG ANTI-MATRIPTASE/MT-SP1 RABBIT PAB 2399
IM11L-100UG ANTI-TIMP-2 (AB-1) MOUSE MAB (T2-101) 4124
IM13L-100UG ANTI-UPA (AB-1) MOUSE MAB (5) 4124
IM15L-100UG ANTI-UPA (AB-3) MOUSE MAB (16) 4066
IM16-100UG ANTI-CATHEPSIN D (AB-2) RABBIT PAB 4066
IM27L-100UG ANTI-CATHEPSIN B (AB-1) MOUSE MAB (CA10) 4505
IM27L-20UG ANTI-CATHEPSIN B (AB-1) MOUSE MAB (CA10) 1336
IM29L-100UG ANTI-PAI-1 (AB-1) MOUSE MAB (2) 4124
IM31L-100UG ANTI-PAI-1 (AB-3) MOUSE MAB (7) 4066
IM32-100UG ANTI-TIMP-1 (AB-1) MOUSE MAB (7-6C1) 4124
IM32-20UG ANTI-TIMP-1 (AB-1) MOUSE MAB (7-6C1) 1390
IM33-100UG ANTI-MMP-2 (AB-3) MOUSE MAB (42-5D11) 4124
IM33-20UG ANTI-MMP-2 (AB-3) MOUSE MAB (42-5D11) 1361
IM35-100UG ANTI-MMP-1 (AB-1) MOUSE MAB (41-1E5) 4124
IM35-20UG ANTI-MMP-1 (AB-1) MOUSE MAB (41-1E5) 1390
IM36-100UG ANTI-MMP-3 (AB-1) MOUSE MAB (55-2A4) 3642
IM37-100UG ANTI-MMP-9 (AB-3) MOUSE MAB (56-2A4) 3978
IM37-20UG ANTI-MMP-9 (626-644) (AB-3) MOUSE MAB (5 1346
IM38-100UG ANTI-MMP-8 (AB-1) MOUSE MAB (115-13D2) 4066
IM39-100UG ANTI-MT1-MMP (AB-1) MOUSE MAB (114-IF2) 4124
IM40-100UG ANTI-MMP-7 (AB-1) MOUSE MAB (141-7B2) 4066
IM41-100UG ANTI-TIMP-1 (AB-2) MOUSE MAB (147-6D11) 4066
IM42-100UG ANTI-MT1-MMP (AB-3) MOUSE MAB (114-6G6) 4124
IM43-100UG ANTI-TIMP-3 MOUSE MAB (136-13H4) 4066
IM44-100UG ANTI-MMP-13 (AB-1) MOUSE MAB (181-15A12) 4066
IM46-100UG ANTI-NEUTROPHIL ELASTASE MOUSE MAB (121- 3448
IM47-100UG ANTI-MMP-7 (AB-2) MOUSE MAB (176-5F12) 4066
IM48-100UG ANTI-MMP-13 (AB-1) MOUSE MAB (181-15A12) 4066
IM51-100UG ANTI-MMP-2 (AB-4) MOUSE MAB (75-7F7) 4124
IM51-20UG ANTI-MMP-2 (AB-4) MOUSE MAB (75-7F7) 1024
IM53-100UG ANTI-MMP-2 (AB-6) MOUSE MAB (CA-4001) 4124
IM55-100UG ANTI-CATHEPSIN K MOUSE MAB (182-12G5) 4066
IM56-100UG ANTI-TIMP-2 (AB-2) MOUSE MAB (67-4H11) 3920
IM57-100UG ANTI-MT1-MMP (AB-4) MOUSE MAB (113-5B7) 4124
IM61-100UG ANTI-MMP-9 (AB-7) MOUSE MAB (GE-213) 4124
IM63-100UG ANTI-TIMP-1 (AB-4) MOUSE MAB (102D1) 4066
IM68-100UG ANTI-MMP-2 (AB-8) MOUSE MAB (VB3) 4066
IM71-100UG ANTI-MMP-7 (AB-3) MOUSE MAB (ID2) 4066
IM72-100UG ANTI-MMP-9 (AB-8) MOUSE MAB (IA5) 4124
IM73-100UG ANTI-MMP-9 (AB-9) MOUSE MAB (ID4) 4066
IM78-100UG ANTI-MMP-13 (AB-4) MOUSE MAB (VIIIA2) 4066
IM80-100UG ANTI-MMP-13 (AB-6) MOUSE MAB (VIIIC4) 4066
IM81-200UG ANTI-MMP-13 (AB-7) MO MAB (LIPCO IID1) 3883
IM82-100UG ANTI-TIMP-2 (AB-4) MOUSE MAB (T2-N IC3) 4066
IM86-50UG ANTI-MMP-11 (AB-2) MOUSE MAB (SL3-05) 3657
IP02-1.5ML PROTEIN-A AGAROSE SUSPENSION 1335
IP04-1.5ML PROTEIN G PLUS-AGAROSE SUSPENSION 1335
IP05-1.5ML PROTEIN G PLUS/PROTEIN A-AGAR SUSPENSION 1168
IP06-10ML PROTEIN A-AGAROSE SUSPENSION 7086
IP06-1ML PROTEIN A-AGAROSE SUSPENSION 1450
IP06-5ML PROTEIN A-AGAROSE SUSPENSION 5031
IP08-10ML PROTEIN G PLUS-AGAROSE SUSPENSION 11967
IP08-1ML PROTEIN G PLUS-AGAROSE SUSPENSION 2424
IP08-5ML PROTEIN G PLUS-AGAROSE SUSPENSION 6435
IP10-10ML PROTEIN G PLUS/PROTEIN A-AGAR SUSPENSION 9675
IP10-1ML PROTEIN G PLUS/PROTEIN A-AGAR SUSPENSION 2424
IP10-5ML PROTEIN G PLUS/PROTEIN A-AGAROSE 6700
LP02-100UG ANTI-LDL RECEPTOR MOUSE MAB (15C8) 4124
NA02-100UG ANTI-2,2,7-TRIMETHYLGUANO MO MAB (K121) 4124
NA02A-0.5ML ANTI-2,2,7-TRIMETHYLGUANO MO MAB AG CONJ 6110
NA03-200UG ANTI-PCNA (AB-1) MOUSE MAB (PC10) 4124
NA03F-100UG ANTI-PCNA (AB-1) MO MAB (PC10) FITC CONJ 4446
NA13-100UG ANTI-RP-A (AB-1) MOUSE MAB (RPA70-9) 4124
NA14-100UG ANTI-TOPOISOMERASE II MO MAB (SWT3D1) 4124
NA18-100UG ANTI-RP-A (AB-2) MOUSE MAB (RPA34-19) 4124
NA19L-100UG ANTI-RP-A (AB-3) MOUSE MAB (RPA34-20) 4124
NA20-100UG ANTI-BRDU (AB-2) MOUSE MAB (ZBU30) 3182
NA26-100UG ANTI-MSH2 (AB-1) MOUSE MAB (GB12) 4124
NA27-100UG ANTI-MSH2 (AB-2) MOUSE MAB (FE11) 4154
NA28-100UG ANTI-MLH1 (AB-1) MOUSE MAB (14) 4124
NA29-100UG ANTI-P16 (AB-1) MOUSE MAB (DCS-50.1/H4) 4124
NA30-100UG ANTI-PMS2 MOUSE MAB (9) 4066
NA35-100UG ANTI-P27KIP-1 (AB-2) MOUSE MAB (DCS72) 4066
NA36-100UG ANTI-P57KIP-2 (AB-2) MOUSE MAB (TFE42) 4066
NA43L-100UG ANTI-OCT-1 (AB-3) MOUSE MAB (YL8) 5914
NA44-100UG ANTI-OCT-2 MOUSE MAB (PT1) 4066
NA46-100UG ANTI-P300 MOUSE MAB (NM-11) 4066
NA49-100UG ANTI-E2F1 (AB-1) MOUSE MAB (KH95) 3993
NA52-100UG ANTI-KU (P80) (AB-1) MOUSE MAB (111) 4066
NA54-100UG ANTI-KU (P80) (AB-3) MOUSE MAB (S10B1) 4066
NA57-100UG ANTI-DNA-PK (AB-2) MOUSE MAB (18-2) 4124
NA61-100UG ANTI-BRDU (AB-3) MOUSE MAB (MOBU-1) 4124
NA63-100UG ANTI-PTB PROTEIN (AB-1) MOUSE MAB (SH54) 4066
NA64-100UG ANTI-LEF-1 (AB-1) MOUSE MAB (REMB1) 4066
NA66-50UG ANTI-XPA (AB-1) MOUSE MAB (5A2) 4066
NA70-100UG ANTI-P14ARF (AB-2) MOUSE MAB (14PO2) 4066
NA71-100UG ANTI-RAD51 (AB-2) MOUSE MAB (51RAD01) 4640
NA72-100UG ANTI-RAD9 MOUSE MAB (93A535) 4446
NA73-100UG ANTI-ORC2 (AB-2) MOUSE MAB (920 4-41) 4066
NA78-100UL ANTI-E2F4 (AB-2) MOUSE MAB (WUF11) 4900
NA79-100UL ANTI-E2F6 MOUSE MAB (TFE61) 4856
NA81-50UG ANTI-5-METHYLCYTOSINE MO MAB (162 33 D3) 3540
NB01-200UL ANTI-UNIV NOS MO MAB (NOS-3F7-B11-B5) 4168
NB04-100UL ANTI-ACETYLCHOLINESTERASE MO MAB (ZR3) 4329
NB05L-100UL ANTI-CHOLINE ACETYLTRANSFERASE RAT MAB 8070
NB07-200UG ANTI-SYNAPTOBREVIN (AB-2) MO MAB (SP11) 3993
NB10-100UL ANTI-TRANS-GOLGI NET 38 MO MAB (2F7.1) 4329
NB12-100UL ANTI-CA2+/CALMOD KIN II ASUB MO MAB(6G9) 4810
NB13-100UL ANTI-CA2+/CALMOD KIN II A PHOSPH MO MAB 4329
NB19-100UG ANTI-ANKYRINB MOUSE MAB (2.20) 4066
NB20-100UG ANTI-ANKYRING MOUSE MAB (463) 4066
NB21-100UG ANTI-N-ETHYLMAL-SENS FTR MO MAB (NSF-1) 4066
NB28-100UG ANTI-DYNAMIN MOUSE MAB (D5) 4066
NB36-200UG ANTI-PRION PRO(PRP) MO MAB (F89/160.1.5) 4329
NB37-100UG ANTI-GOLGI APPARATUS MOUSE MAB (AE-6) 4066
NB37-10UG ANTI-GOLGI APPARATUS MOUSE MAB (AE-6) 1024
NB38-100UG ANTI-MYELIN PROTEOLIPID PROT MO MAB 4183
NE1000-100UL PD ANTI-TH (PSER19) RABBIT PAB 5558
NE1001-100UL PD ANTI-TH (PSER31) RABBIT PAB 5558
NE1004-100UL ANTI-APOLIPOPROTEIN E MOUSE MAB (E6D7) 4973
NE1008-50UL ANTI-PEN-2, N-TERMINAL RABBIT PAB 3408
NE1011-50UL ANTI-HIP-2 RABBIT PAB 2370
NE1012-50UL ANTI-B-AMYLOID, MO AND RAT SPEC RB PAB 2516
NE1013-50UL ANTI-PGP9.5 RABBIT PAB 2618
NE1015-100UL ANTI-GFAP COCKTAIL MOUSE MAB (SMI-22) 4417
NE1016-100UL ANTI-PAN-AXONAL NF MARKER MO MAB 4870
NE1017-100UL ANTI-PAN-NEURO NF MARKER MO MAB(SMI-311) 4870
NE1018-100UL ANTI-MYELIN BASIC PROTEIN MO MAB(SMI-94) 5821
NE1019-100UL ANTI-MYELIN BASIC PROTEIN MO MAB(SMI-94) 5317
NE1020-100UL ANTI-MYELIN CNPASE MOUSE MAB (SMI-91) 4417
NE1022-100UL PD ANTI-NEUROFILAMENT-H MO MAB (SMI-31) 4870
NE1023-100UL ANTI-NF H NON-PHOSPHO MO MAB (SMI-32) 4870
NE1024-100UL ANTI-P75 NEUROTROPHIN RECEPTOR RB PAB 5514
NE1025-100UL ANTI-PROBACE1 (24-45) RABBIT PAB 5514
NE1026-100UL ANTI-RT BLOOD-BRAIN BAR MO MAB (SMI-71) 4534
NE1030-100UL PHOSDETECTANTI-&ALPHA-SYNUCLEIN(PSER129) 4315
NE1031-100UL PHOSPHODETECTANTI-5-LIPOXYGENASE(PSER523 4315
NE1032-100UL PHODETECTANTI-NMDARECEPTORNR2BSUBUNIT(PT 4315
NE1033-100UL PHOSDETECTANTI-NMDARECNR2BSUB(PTYR1336)R 4315
NE1034-100UL PHOSDETECTANTI-NMDARECEPTORNR2BSUB(PSER1 4315
NE1035-100UL PD ANTI-PARKIN (PSER 101) RABBIT PAB 4315
NE1036-100UL PHOSPHODETECT ANTI-PARKIN(PSER378)RABPAB 4315
NE1037-100UG ANTI-APOC1 MOUSE MAB (2E2-1A3) 5760
NE1038-100UG ANTI-F13A1 MOUSE MAB (M1) 5760
NE1039-100UG ANTI-IGFBP6 MOUSE MAB (1H2-2D10) 5760
NE1040-100UG ANTI-PLTP MOUSE MAB (2F3-G4) 5760
NE1041-100UG ANTI-AGT MOUSE MAB (1A10) 5760
NE1042-100UG ANTI-INHBA RABBIT PAB 3980
NE1043-100UG ANTI-INHBB RABBIT PAB 3980
NE1044-100UL ANTI-MDK RABBIT PAB 3980
NE1045-100UG ANTI-APOM MOUSE MAB (1F10) 3980
NE1046-100UG ANTI-F12 MOUSE MAB (3A3) 3519
NI01-100UG NORMAL RABBIT IGG 1170
NI02-100UG NORMAL GOAT IGG 1170
NI03-100UG NORMAL MOUSE IGG 1170
NI04-100UG NORMAL RAT IGG 1170
NR07-100UG ANTI-RYANODINE RECEPTOR MO MAB (C3-33) 4417
NR09-100UL ANTI-IP3 RECEPTOR RABBIT PAB 4168
NS01L-1ML NORMAL RABBIT SERUM 803
NS02L-1ML NORMAL GOAT SERUM 803
NS03L-1ML NORMAL MOUSE SERUM 803
OB02-100UG ANTI-B-GALACTOSIDASE MOUSE MAB (200-193) 3028
OB03-100UG ANTI-GST (AB-2) MOUSE MAB (8-326) 4066
OB03-20UG ANTI-GST (AB-2) MOUSE MAB (8-326) 1024
OB05-100UG ANTI-HIS-TAG PROTEIN MO MAB (13/45/31/2) 4124
OB07-100UG ANTI-GST (AB-3) MOUSE MAB (TC112) 4066
OB09-100UG ANTI-LUCIFERASE MOUSE MAB (LUCI) 4066
OP01-100UG ANTI-V-H-RAS (AB-1) RAT MAB (Y13-259) 4124
OP01A-0.5ML ANTI-V-H-RAS RT MAB (Y13-259) AGAR CONJ 5338
OP01L-100UG ANTI-V-H-RAS (AB-1) RAT MAB (Y13-259) 4066
OP02-100UG ANTI-V-FES RAT MAB (F-113) 4066
OP03-100UG ANTI-P53 (PANTROPIC) MO MAB (PAB421) 4066
OP03-20UG ANTI-P53 (PANTROPIC) MO MAB (PAB421) 1390
OP03F-100UG ANTI-P53 (PAN) MO MAB (PAB421) FITC CONJ 4446
OP03L-100UG ANTI-P53 (PANTROPIC) MO MAB (PAB421) 4124
OP07-100UG ANTI-V-SRC (AB-1) MOUSE MAB (327) 4124
OP07A-.5ML ANTI-V-SRC MO MAB (327) AGAR CONJ. 5017
OP07L-100UG ANTI-V-SRC (AB-1) MOUSE MAB (327) 4124
OP09-100UG ANTI-P53 (PANTROPIC) MO MAB (PAB1801) 3700
OP09-200UG ANTI-P53 (PANTROPIC) MO MAB (PAB1801) 4651
OP09L-100UG ANTI-P53 (PANTROPIC) MO MAB (PAB1801) 3642
OP10-200UG ANTI-C-MYC (AB-1) MOUSE MAB (9E10) 4198
OP102-100UG ANTI-VON HIPPEL-LINDAU MO MAB (IG33) 4066
OP104L-100UG ANTI-P53 (PANTROPIC) MO MAB (PAB1802) 4066
OP107-100UG ANTI-BRCA1 (AB-4) MOUSE MAB (SD118) 4124
OP108-100UG ANTI-P73 (AB-1) MOUSE MAB (ER-13) 4066
OP109-100UG ANTI-P73 (AB-2) MOUSE MAB (ER-15) 4124
OP109L-100UG ANTI-P73 (AB-2) MOUSE MAB (ER-15) 4066
OP10F-100UG ANTI-C-MYC MO MAB (9E10) FITC CONJ 4446
OP10L-200UG ANTI-C-MYC (AB-1) MOUSE MAB (9E10) 4124
OP110-100UG ANTI-P73 (AB-3) MOUSE MAB (GC-15) 4124
OP115-100UG ANTI-MDM2 (AB-2) MOUSE MAB (2A10) 4124
OP119-100UG ANTI-C-ERBB3 MO MAB (H3.90.6 OR AB90) 4124
OP120-100UG ANTI-C-ERBB3 (AB-5) MOUSE MAB (H3.105.5) 4066
OP121-100UG ANTI-C-ERBB4 (AB-1) MOUSE MAB (H4.77.16) 4640
OP126L-100UG ANTI-MICROPHTHALMIA (AB-1) MO MAB (C5) 5914
OP128-100UG ANTI-PLZF MOUSE MAB (2A9) 4124
OP128-10UG ANTI-PLZF MOUSE MAB (2A9) 1039
OP128L-100UG ANTI-PLZF MOUSE MAB (2A9) 4124
OP129-100UG ANTI-TRF2 MOUSE MAB (4A794) 4124
OP13-100UG ANTI-N-MYC MOUSE MAB (NCM II 100) 4124
OP133-100UG ANTI-IKKA MOUSE MAB (14A231) 4772
OP134-100UG ANTI-IKKB MOUSE MAB (10AG2) 5082
OP136-100UG ANTI-RB (AB-11) MOUSE MAB (1F8) 4066
OP139-100UG ANTI-WILM'S TUMOR PROTEIN MO MAB (WLM04) 4066
OP13L-100UG ANTI-N-MYC MOUSE MAB (NCM II 100) 4066
OP140-100UG ANTI-P53 (PANTROPIC) MO MAB (DO-7) 4124
OP14-100UG ANTI-C-ERBB2/C-NEU (AB-2) MO MAB (9G6) 4124
OP142-100UG PD ANTI-IKBA (PSER32/36) MO MAB(39A1431) 6861
OP143-100UG ANTI-MDM2 (AB-3) MOUSE MAB (4B11) 3315
OP144-100UG ANTI-MDM2 (AB-4) MOUSE MAB (2A9C1.18) 4124
OP144-20UG ANTI-MDM2 (AB-4) MOUSE MAB (2A9C1.18) 1390
OP145-100UG ANTI-MDM2 (AB-5) MOUSE MAB (4B2C1.11) 4124
OP146-100UG ANTI-MDM2 (AB-6) MOUSE MAB (5B10C) 4066
OP14L-100UG ANTI-C-ERBB2/C-NEU (AB-2) MO MAB (9G6) 4124
OP15-100UG ANTI-C-ERBB2/C-NEU (AB-3) MO MAB (3B5) 4680
OP158-100UL ANTI-PSA (AB-1) MOUSE MAB (EP-PR8) 3276
OP159-100UL ANTI-S100 PROTEIN (AB-1) MO MAB (4C4.9) 3364
OP15F-100UG ANTI-C-ERBB2/C-NEU MO MAB (3B5) FITC 4446
OP15L-100UG ANTI-C-ERBB2/C-NEU (AB-3) MO MAB (3B5) 4124
OP160-100UL ANTI-TYROSINASE MOUSE MAB (T311) 3364
OP16-100UG ANTI-C-ERBB2/C-NEU (AB-4) MO MAB(7.16.4) 4124
OP161-100UG ANTI-CD10 MOUSE MAB (SN5C) 4066
OP164-100UG ANTI-CD34 MOUSE MAB (QBEND/10) 4066
OP168-100UG ANTI-CD55 (55CO2) MOUSE MAB (55C02) 4066
OP16L-100UG ANTI-C-ERBB2/C-NEU (AB-4) MO MAB(7.16.4) 4124
OP171-100UG ANTI-CD63 MOUSE MAB (NKI/C-3) 4066
OP17-200UG ANTI-C-FOS (AB-1) MOUSE MAB (2G9C3) 4124
OP176-100UG ANTI-MART-1 (AB-1) MOUSE MAB (A103) 4066
OP17L-200UG ANTI-C-FOS (AB-1) MOUSE MAB (2G9C3) 4066
OP180-100UG ANTI-NOXA MOUSE MAB (114C307) 5489
OP181-100UG ANTI-DELTANP73 MOUSE MAB (38C674) 4534
OP183-100UG ANTI-TLR 6 MOUSE MAB (86B1153) 4534
OP184-100UG ANTI-TLR 8 MOUSE MAB (44C143) 4534
OP185-100UG ANTI-TLR 9 (AB-1) MOUSE MAB (26C593) 4534
OP187-100UG ANTI-EPCAM-1 (AB-1) MOUSE MAB (VU-1D9) 4124
OP188-100UG ANTI-FAP MOUSE MAB (F11-24) 4124
OP19-100UG ANTI-C-ABL (AB-2) MOUSE MAB (19-110) 4124
OP191-200UL ANTI-BCRP MOUSE MAB (BXP-21) 3101
OP194-100UG ANTI-ITK MOUSE MAB (2F12) 4329
OP195-100UL PD ANTI-C-ERBB2/C-NEU (PS1113) MO MAB 6172
OP20-100UG ANTI-C-ABL (AB-3) MOUSE MAB (24-21) 4505
OP21-100UG ANTI-PAN-RAS (AB-1) MOUSE MAB (F132-62) 4124
OP22-100UG ANTI-PAN-RAS (AB-2) MOUSE MAB (F111-85) 4124
OP23-100UG ANTI-C-H-RAS (AB-1) MO MAB (F235-1.7.1) 3700
OP23-200UG ANTI-C-H-RAS (AB-1) MO MAB (F235-1.7.1) 4651
OP24-100UG ANTI-C-K-RAS (AB-1) MOUSE MAB (234-4.2) 3920
OP25-100UG ANTI-C-N-RAS (AB-1) MOUSE MAB (F155-227) 4124
OP26-100UG ANTI-BCR (AB-2) MOUSE MAB (7C6) 4066
OP28-100UG ANTI-RB (AB-1) MOUSE MAB (C36) 3057
OP28A-0.5ML ANTI-RB (AB-1) MO MAB (C36) AGAR CONJ 5338
OP29-100UG ANTI-P53 (AB-3) (MUTANT) MO MAB (PAB240) 3700
OP29-200UG ANTI-P53 (AB-3) (MUTANT) MO MAB (PAB240) 4651
OP29-20UG ANTI-P53 (AB-3) (MUTANT) MO MAB (PAB240) 1039
OP29L-100UG ANTI-P53 (AB-3) (MUTANT) MO MAB (PAB240) 3642
OP30-100UG ANTI-C-MYC (AB-2) MOUSE MAB (8) 4124
OP30-20UG ANTI-C-MYC (AB-2) MOUSE MAB (8) 1039
OP30L-100UG ANTI-C-MYC (AB-2) MOUSE MAB (8) 4066
OP31-100UG ANTI-C-MYC (AB-3) MOUSE MAB (33) 4124
OP32-100UG ANTI-P53 (WILD TYPE) MO MAB (PAB246) 4124
OP32L-100UG ANTI-P53 (WILD TYPE) MO MAB (PAB246) 4066
OP33-100UG ANTI-P53 (WILD TYPE) MO MAB (PAB1620) 4124
OP33-20UG ANTI-P53 (WILD TYPE) MO MAB (PAB1620) 1511
OP38-100UG ANTI-PAN-RAS VAL12 (AB-1) MO MAB (DWP) 4124
OP39-100UG ANTI-C-ERBB2/C-NEU (AB-5) MO MAB (TA-1) 4124
OP40-100UG ANTI-PAN-RAS (AB-3) MOUSE MAB (RAS 10) 4124
OP41-100UG ANTI-PAN-RAS (AB-4) MOUSE MAB (RAS 11) 4066
OP43-100UG ANTI-P53 (PANTROPIC) MO MAB (DO-1) 4680
OP43-20UG ANTI-P53 (PANTROPIC) MO MAB (DO-1) 1390
OP43A-.5ML ANTI-P53 (PAN) MO MAB (DO-1) AGAR CONJ 5338
OP43F-100UG ANTI-P53 (PAN) MO MAB (DO-1) FITC CONJ. 4446
OP43L-100UG ANTI-P53 (PANTROPIC) MO MAB (DO-1) 4505
OP44-100UG ANTI-APC (AB-1) MOUSE MAB (FE9) 4505
OP45-100UG ANTI-DCC MOUSE MAB (AF5) 4505
OP46-100UG ANTI-MDM2 (AB-1) MOUSE MAB (IF2) 4154
OP47L-100UG ANTI-APC (AB-2) MOUSE MAB (IE1) 4446
OP48-100UG ANTI-NM23 (AB-1) MOUSE MAB (NM301) 4446
OP53-100UG ANTI-C-FOS (AB-3) MOUSE MAB (CS93.1.18) 4066
OP55-100UG ANTI-C-JUN/AP-1 (AB-3) MOUSE MAB (76) 4066
OP56L-100UG ANTI-C-JUN/AP-1 (AB-4) MOUSE MAB (IB) 4066
OP60-100UG ANTI-BCL-2 (AB-1) MOUSE MAB (100) 4124
OP62-100UG ANTI-APC (AB-5) MOUSE MAB (CF11) 4505
OP64-100UG ANTI-P21WAF1 (AB-1) MOUSE MAB (EA10) 4198
OP64-20UG ANTI-P21WAF1 (AB-1) MOUSE MAB (EA10) 1390
OP64F-100UG ANTI-P21WAF1 MO MAB (EA10) FITC CONJ. 5338
OP66-100UG ANTI-RB (AB-5) MOUSE MAB (LM95.1) 3101
OP67-100UG ANTI-C-ERBB2/C-NEU (AB-6) MO MAB (OD-3) 4066
OP68-100UG ANTI-P21WAF1 (AB-3) MOUSE MAB (DF10) 4066
OP71-100UG ANTI-TRYPTOPHAN HYDROXYLASE MO MAB (PH8) 4066
OP74-100UG ANTI-PROTEIN KINASE C MO MAB (MC5) 4066
OP76-100UG ANTI-P21WAF1 (AB-4) MOUSE MAB (65) 4124
OP77-100UG ANTI-RB (AB-6) MOUSE MAB (AF11) 3057
OP79-100UG ANTI-P21WAF1 (AB-6) MOUSE MAB (22) 4124
OP80-100UG ANTI-APC (AB-7) MOUSE MAB (CC-1) 4680
OP91-100UG ANTI-BCL-2 (AB-3) MOUSE MAB (4D7) 4066
OP92-100UG ANTI-BRCA1 (AB-1) MOUSE MAB (MS110) 4198
OP93-100UG ANTI-BRCA1 (AB-2) MOUSE MAB (MS13) 4124
OP95-100UG ANTI-BRCA2 (AB-1) MOUSE MAB (2B) 4124
OP97-100UG ANTI-MTOR/FRAP (AB-2) MOUSE MAB (22C2) 4037
OP99L-100UG ANTI-RB (AB-8) MOUSE MAB (XZ55) 3057
OR03L-200UG STREPTAVIDIN, HRP CONJUGATE 1003
OR04L-200UG STREPTAVIDIN, AP CONJUGATE 1003
OS02-200UG ANTI-MOUSE IGG (GOAT) PURIFIED ANTIBODY 878
OS03B-200UG ANTI-RABBIT IGG (GOAT) BIOTIN CONJUGATE 1016
PC04-100UG ANTI-C-ERBB2/C-NEU (AB-1) RABBIT PAB 3876
PC05-100UG ANTI-C-FOS (AB-2) RABBIT PAB 3876
PC05L-100UG ANTI-C-FOS (AB-2) RABBIT PAB 3876
PC07-100UG ANTI-C-JUN/AP-1 (AB-2) RABBIT PAB 3832
PC07L-100UG ANTI-C-JUN/AP-1 (AB-2) RABBIT PAB 3832
PC08-100UG ANTI-EGF (AB-3) RABBIT PAB 3876
PC09-100UG ANTI-PTHLP (AB-2) RABBIT PAB 3876
PC100-100UG ANTI-PARP-1 (AB-1) RABBIT PAB 3832
PC103-100UG ANTI-BAX (AB-4) RABBIT PAB 3832
PC105-100UG ANTI-FAS LIGAND (AB-3) RABBIT PAB 3832
PC107-100UG ANTI-CASPASE-2 RABBIT PAB 3832
PC109-100UL ANTI-CASPASE-4 (AB-1) RABBIT PAB 3832
PC10L-100UG ANTI-PAN-RAS ASP12 (AB-1) RABBIT PAB 3832
PC116-100UG ANTI-ATM (AB-3) RABBIT PAB 3876
PC127-100UG ANTI-DNA-PK (AB-1) RABBIT PAB 3876
PC130-100UL ANTI-RAD51 (AB-1) RABBIT PAB 3759
PC130T-10UL ANTI-RAD51 (AB-1) RABBIT PAB 907
PC13-100UG ANTI-RB (AB-2) RABBIT PAB 3057
PC132-100UL ANTI-CYCLIN A (AB-5) RABBIT PAB 3993
PC133-100UL ANTI-CYCLIN B1 (AB-3) RABBIT PAB 3993
PC136-100UL ANTI-NF-KB (P50) (AB-1) RABBIT PAB 4739
PC136-20UL ANTI-NF-KB (P50) (AB-1) RABBIT PAB 1112
PC137-100UL ANTI-NF-KB (P65, RELA) (AB-1) RABBIT PAB 4797
PC137-20UL ANTI-NF-KB (P65, RELA) (AB-1) RABBIT PAB 1700
PC138-100UL ANTI-NF-KB (P65, RELA) (AB-2) RABBIT PAB 4739
PC139-100UL ANTI-CREL RABBIT PAB 4797
PC139-20UL ANTI-CREL RABBIT PAB 1127
PC142-100UL ANTI-IKBA (AB-2) RABBIT PAB 4797
PC143-100UL ANTI-IKBB (AB-1) RABBIT PAB 4739
PC149-25UG ANTI-B-AMYLOID (1-40) RABBIT PAB 5265
PC150-25UG ANTI-B-AMYLOID (1-42) RABBIT PAB 5338
PC151-25UG ANTI-B-AMYLOID (1-43) RABBIT PAB 5265
PC152-100UG ANTI-PAN B-AMYLOID RABBIT PAB 6216
PC154-100UL ANTI-EXCIT A A TRANSPORTER (GLT-1)RB PAB 4183
PC158-100UL ANTI-A1 ADENOSINE RECEPTOR RABBIT PAB 4592
PC160-100UL ANTI-ADRENERGIC A1 RECEPTOR RABBIT PAB 4446
PC16-100UG ANTI-FIBROBLAST GF, BASIC (AB-2) RB PAB 3876
PC161-100UL ANTI-ADRENERGIC A2A RECEPTOR RABBIT PAB 4446
PC162-100UL ANTI-ADRENERGIC B1 RECEPTOR RABBIT PAB 5002
PC165L-100UL ANTI-OPIOID U RECEPTOR RABBIT PAB 5689
PC168-50UG ANTI-ESTROGEN RECEPTOR B (AB-1) RB PAB 4446
PC170-200UL ANTI-GLUCOCORTICOID RECPTR (AB-1) RB PAB 4706
PC17-100UG ANTI-PDGF RECEPTOR B (AB-1) RABBIT PAB 3832
PC171-50UL ANTI-GLUCOCORTICOID RECPTR B RB PAB 4973
PC175-100UL ANTI-B-COP RABBIT PAB 4183
PC176-100UL ANTI-SEROTONIN 2A (5-HT2A) RECPTR RB PAB 5777
PC177L-100UL ANTI-SEROTONIN (5-HT) TRANSPORTER RB PAB 5660
PC187L-100UG ANTI-PLEIOTROPHIN GOAT PAB 3262
PC195L-100UG ANTI-IGF-I (AB-2) GOAT PAB 4066
PC196L-100UG ANTI-IGF-I RECEPTOR (AB-2) GOAT PAB 4914
PC20-100UG ANTI-PROTEIN KINASE C (AB-1) RABBIT PAB 3832
PC205L-100UL ANTI-CALCITONIN GENE REL PEP(CGRP)RB PAB 4402
PC206L-100UL ANTI-CHOLECYSTOKININ-8 RABBIT PAB 4402
PC208L-100UL ANTI-CORTICOTROPIN REL FACTOR RB PAB 4402
PC210-100UL ANTI-DYNORPHIN A (1-17) RABBIT PAB 3642
PC21-100UG ANTI-PDGF (AB-1) RABBIT PAB 3832
PC213L-100UL ANTI-GABA RABBIT PAB 5060
PC223L-100UL ANTI-NEUROPEPTIDE Y RABBIT PAB 5145
PC225L-100UL ANTI-NEUROTENSIN RABBIT PAB 3569
PC226L-100UL ANTI-OXYTOCIN RABBIT PAB 4373
PC232L-100UL ANTI-SUBSTANCE P RABBIT PAB 3569
PC234L-100UL ANTI-VASOPRESSIN RABBIT PAB 4300
PC237-6ML ANTI-NEURONAL SPECIFIC ENOLASE RB PAB 2677
PC244-50UG ANTI-PRESENILIN 1 (31-46) (AB-1) RB PAB 3262
PC246-100UG ANTI-GLUR1 RABBIT PAB 4241
PC248-100UL ANTI-SEROTONIN 5A (5-HT5A) RECPTR RB PAB 5689
PC250L-100UL ANTI-GABA TRANSPORTER GAT-1 RABBIT PAB 4856
PC25-100UG ANTI-CDC2/CDK1 (AB-1) RABBIT PAB 2472
PC253L-100UL ANTI-CALBINDIN D-28K (AB-1) RABBIT PAB 4885
PC254L-100UL ANTI-CALRETININ RABBIT PAB 4885
PC255L-100UL ANTI-PARVALBUMIN RABBIT PAB 4885
PC267-50UG ANTI-PRESENILIN 1 (303-316) RB PAB 3262
PC268-100UL ANTI-PIG3 (AB-1) RABBIT PAB 3832
PC27L-100UG ANTI-C-ERBB3 (AB-1) RABBIT PAB 3832
PC28-100UG ANTI-JUNB RABBIT PAB 3832
PC283-100UG ANTI-ETO (AB-1) RABBIT PAB 3832
PC285-100UG ANTI-AML1/RHD DOMAIN (AB-2) RABBIT PAB 3876
PC286-100UG ANTI-AML2 RABBIT PAB 3832
PC287-100UG ANTI-AML3 RABBIT PAB 3883
PC309-200UG ANTI-MMP-9 (AB-5) SHEEP PAB 3832
PC31-100UG ANTI-C-TRK RABBIT PAB 3832
PC311-200UG ANTI-MMP-1 (AB-3) SHEEP PAB 3832
PC312-200UG ANTI-MMP-2 (AB-5) SHEEP PAB 3832
PC313-500UL ANTI-FACTOR VIII RELATED AG/VWF RB PAB 4066
PC314-500UG ANTI-FAK RABBIT PAB 3993
PC315-20UG ANTI-VEGF (AB-4) RABBIT PAB 1039
PC315-500UG ANTI-VEGF (AB-4) RABBIT PAB 4124
PC317L-100UG ANTI-ANGIOGENIN GOAT PAB 4066
PC319L-100UG ANTI-HB-EGF (AB-1) GOAT PAB 4124
PC322L-100UG ANTI-VEGF RECEPTOR 1 GOAT PAB 6157
PC323-100UG ANTI-CYTOCHROME C (AB-1) SHEEP PAB 4066
PC323-50UG ANTI-CYTOCHROME C (AB-1) SHEEP PAB 2955
PC325-50UL ANTI-A-SYNUCLEIN (AB-1) GUINEA PIG PAB 4066
PC332-100UG ANTI-CASPASE-10 (AB-1) (221-234) RB PAB 4066
PC334-100UG ANTI-CASPASE-7 (AB-1) RABBIT PAB 4066
PC335-100UG ANTI-CASPASE-8 (AB-1) RABBIT PAB 4066
PC339-1SET ANTI-EAAT2 (AB-2) RABBIT PAB 3993
PC340-100UG ANTI-HEME OXYGENASE-1 (AB-1) RABBIT PAB 4066
PC34-100UG ANTI-C-KIT RABBIT PAB 3876
PC342-100UG ANTI-MMP-2 (AB-7) RABBIT PAB 3832
PC343-1SET ANTI-NEUROPILIN-1 RABBIT PAB 4124
PC344-100UG ANTI-NETRIN-1 (AB-1) RABBIT PAB 4124
PC345-1SET ANTI-OREXIN A (AB-1) RABBIT PAB 3993
PC346-100UG ANTI-OREXIN B (AB-1) RABBIT PAB 3581
PC347-1SET ANTI-SEROTONIN 3 (5-HT3) RECEPTOR RB PAB 3883
PC35-1EA ANTI-P53 (AB-7) (PANTROPIC) SHEEP PAB 4987
PC361-100UL ANTI-PRESENILIN 1 (14-33) (AB-3) GT PAB 4518
PC362-1SET ANTI-OREXIN A (AB-2) RABBIT PAB 4066
PC364-1SET ANTI-NETRIN-1 (AB-2) RABBIT PAB 5999
PC366-100UG ANTI-DFF45 RABBIT PAB 4066
PC367-100UG ANTI-PL-SCRAMBLASE RABBIT PAB 4066
PC37-100UG ANTI-VEGF (AB-2) RABBIT PAB 3876
PC371-100UG ANTI-ANGIOSTATIN (AB-1) RABBIT PAB 4066
PC373-100UL ANTI-P40 RABBIT PAB 3832
PC376-100UG ANTI-P2X4 RECEPTOR RABBIT PAB 3883
PC38-100UL ANTI-C-FOS (AB-5) RABBIT PAB 3115
PC382-100UG ANTI-PLK1 RABBIT PAB 3832
PC385-50UG ANTI-P73 (AB-4) RABBIT PAB 3832
PC386-50UL PD ANTI-P53 (PSER15) (AB-3) RABBIT PAB 4124
PC386T-5UL PD ANTI-P53 (PSER15) (AB-3) RABBIT PAB 936
PC387-50UL PD ANTI-P53 (PSER392) (AB-4) RABBIT PAB 4066
PC388-100UG ANTI-HMRE-11 RABBIT PAB 3876
PC389-100UG ANTI-CXCR4 (AB-1) RABBIT PAB 3876
PC390-100UG ANTI-CXCR4 (AB-2) RABBIT PAB 3876
PC392-200UL ANTI-TRAIL-R2 (DR5) (AB-1) RB PAB 3832
PC407-100UL ANTI-DYNAMIN II RABBIT PAB 4505
PC408-100UL ANTI-GREEN FLUORESCENT PROTEIN RB PAB 4505
PC409-100UL ANTI-P14ARF (AB-1) RABBIT PAB 3832
PC41-100UG ANTI-CATHEPSIN B (AB-3) RABBIT PAB 3832
PC411-1SET ANTI-P2X3 RECEPTOR RABBIT PAB 3883
PC420-100UG ANTI-CAPSAICIN RECEPTOR (AB-1) RB PAB 4124
PC421-10UG ANTI-VANILLOID RECPTR LIKE PROT-1 RB PAB 1152
PC421-1SET ANTI-VANILLOID RECPTR LIKE PROT-1 RB PAB 3993
PC423-250UG ANTI-CHK1 SHEEP PAB 4066
PC435-100UL ANTI-P19ARF (AB-1) RABBIT PAB 5353
PC441-500UG ANTI-CULLIN-1 RABBIT PAB 4066
PC443-100UG ANTI-CX3CR1 RABBIT PAB 4066
PC446-100UG ANTI-TISSUE TRANSGLUTAMINASE RABBIT PAB 3832
PC449-25UL PD ANTI-TIE2 (PAB-1) RABBIT PAB 4124
PC450-25UL PD ANTI-TIE2 (PTYR1108/1117) RB PAB 4124
PC452-25UL PD ANTI-JNK (PTHR183,TYR185) RABBIT PAB 4066
PC456-25UL PD ANTI-CDK1 SUBSTRATE (AB-1) RABBIT PAB 4066
PC459-25UL PD ANTI-VEGF-R1 (PAB-2) RABBIT PAB 4124
PC460-25UL PD ANTI-VEGFR 2/3 (PAB-1) RABBIT PAB 4124
PC461-25UL PD ANTI-P53 (PSER15) (AB-6) RABBIT PAB 4066
PC463-25UL ANTI-IRS (PTYR896) RABBIT PAB 4066
PC471-100UG ANTI-ASK1 (1360-1372) RABBIT PAB 3832
PC472-100UL ANTI-P51A RABBIT PAB 5075
PC474-50UL ANTI-PCNA (AB-5) RABBIT PAB 3832
PC478-1SET ANTI-BACE (AB-1) RABBIT PAB 3993
PC482-100UL ANTI-14-3-3SIGMA (69-81) RABBIT PAB 3832
PC491-100UG ANTI-TACE (807 - 823) RABBIT PAB 4124
PC497-50UG ANTI-MMP-20 (AB-2) RABBIT PAB 3262
PC504-25UG PD ANTI-RB (PTHR373) RABBIT PAB 4066
PC510-50UL ANTI-AKT1 (AB-1) RABBIT PAB 3832
PC515-50UL PD ANTI-C-MYC (PTHR58,SER62) RABBIT PAB 4066
PC518-50UL PD ANTI-BAD (PSER112) (AB-1) RABBIT PAB 4066
PC519-50UL PD ANTI-BAD (PSER136) (AB-2) RABBIT PAB 4066
PC520-50UL ANTI-ACTIVE CASPASE-7 RABBIT PAB 4066
PC522-100UG ANTI-ANT-1 (AB-1) RABBIT PAB 3832
PC523-100UG ANTI-ANT-1 (AB-2) RABBIT PAB 3832
PC525-100UG ANTI-BNIP3L RABBIT PAB 4066
PC527-100UG ANTI-SURVIVIN (AB-1) RABBIT PAB 4066
PC528-100UG ANTI-ADAM10 (AB-1) RABBIT PAB 4124
PC529-100UG ANTI-BACE (AB-2) RABBIT PAB 5914
PC53-100UG ANTI-GST (AB-1) RABBIT PAB 3072
PC533-100UG ANTI-RIP (AB-1) RABBIT PAB 3832
PC534-100UG ANTI-RIP2 RABBIT PAB 3832
PC536-100UG ANTI-AIF (AB-2) RABBIT PAB 3832
PC538-50UL ANTI-ATR (AB-2) RABBIT PAB 4124
PC538T-5UL ANTI-ATR (AB-2) RABBIT PAB 936
PC540-100UG ANTI-RIBONUCLEOTIDE REDUCTASE R2 RB PAB 3832
PC54-100UG ANTI-MAP KINASE ERK1 (339-353) RB PAB 4592
PC542-100UG ANTI-MMP-13 (AB-8) RABBIT PAB 3832
PC543-50UL ANTI-E6-AP RABBIT PAB 3262
PC544-50UG ANTI-HDAC 1 (467-482) RABBIT PAB 3262
PC548-50UG ANTI-PORIN (AB-5) RABBIT PAB 3941
PC548T-5UG ANTI-PORIN (AB-5) RABBIT PAB 936
PC552-100UG ANTI-ACINUS (AB-2) RABBIT PAB 4066
PC555-100UG ANTI-BACE2 (AB-1) RABBIT PAB 4066
PC556-100UG ANTI-BACE2 (AB-2) RABBIT PAB 4066
PC557-100UG ANTI-CASPASE-12 (AB-1) RABBIT PAB 4066
PC558-100UG ANTI-CASPASE-12 (AB-2) RABBIT PAB 4066
PC56-100UG ANTI-MLH1 (AB-2) RABBIT PAB 5637
PC562-100UG ANTI-BID (AB-1) RABBIT PAB 3832
PC563-100UG ANTI-HTERT RABBIT PAB 3876
PC57-100UG ANTI-MSH2 (AB-3) RABBIT PAB 3832
PC571-50UG ANTI-BMP-1 (AB-1) RABBIT PAB 3262
PC574-50UG ANTI-SMAC/DIABLO (AB-1) RABBIT PAB 3057
PC599-100UL ANTI-ENDOSTATIN (AB-4) RABBIT PAB 3832
PC614-100UG ANTI-RAD17 (AB-1) RABBIT PAB 4592
PC620-50UG ANTI-EDG-1, C-TERMINAL RABBIT PAB 4856
PC626-50UG ANTI-NFAT5 (1439-1455) RABBIT PAB 4651
PC630-100UL ANTI-CD3 RABBIT PAB 3364
PC631-50UL PD ANTI-BRCA1 (PSER1387) RABBIT PAB 3364
PC632-50UL PD ANTI-BRCA1 (PSER1423) RABBIT PAB 3364
PC634-50UL ANTI-NIBRIN RABBIT PAB 3364
PC635-50UL PD ANTI-NBS1 (PSER343) RABBIT PAB 3364
PC638-10T PD ANTI-ELF-2A (AB-1) (PSER52) RB PAB 5104
PC639-10T PD ANTI-ELF-4E (AB-1) (PSER209) RB PAB 5017
PC640-100UL PD ANTI-RB (PSER249,THR252) RB PAB 5075
PC644-50UG PD ANTI-RB (PTHR826) RABBIT PAB 5163
PC645-10T ANTI-CLEAVED BID (AB-1) RABBIT PAB 5163
PC650-100UG ANTI-DC-SIGN/CD209 (AB-1) RABBIT PAB 4066
PC656-100UG ANTI-PID/MTA2 RABBIT PAB 4066
PC66-100UG ANTI-BAX (AB-1) RABBIT PAB 3876
PC669-100UG ANTI-ADAM9 GOAT PAB 5514
PC67-100UG ANTI-BCL-X (AB-1) RABBIT PAB 3832
PC673-100UG ANTI-DECORIN GOAT PAB 5514
PC674-100UG ANTI-TOLL-LIKE RECEPTOR 2 GOAT PAB 4900
PC679-50UG ANTI-CASPASE-3, CLEAVED (AB-2) RB PAB 4457
PC680-50UG ANTI-CASPASE-9, CLEAVED (AB-2) RB PAB 4457
PC68-100UG ANTI-BCL-2 (AB-2) RABBIT PAB 3876
PC684-100UG ANTI-ENDONUCLEASE G RABBIT PAB 5893
PC686-100UG ANTI-PUMA (AB-1) RABBIT PAB 5808
PC69-100UG ANTI-FAS (AB-1) RABBIT PAB 3832
PC691-100UL ANTI-XRCC3 RABBIT PAB 4900
PC695-100UL ANTI-E47 RABBIT PAB 4900
PC696-100UL ANTI-FRA2 (AB-1) RABBIT PAB 4900
PC700-100UL ANTI-PAX-5 RABBIT PAB 4900
PC70-100UG ANTI-14-3-3 (221-242) RABBIT PAB 3832
PC701-100UL ANTI-SP1 RABBIT PAB 4900
PC703-100UL ANTI-USF-1 RABBIT PAB 4900
PC705-50UL ANTI-CYCLIN L RABBIT PAB 4592
PC708-100UL ANTI-NEIL2 RABBIT PAB 4329
PC709-100UL ANTI-MYH RABBIT PAB 4417
PC711-100UL ANTI-CHIP RABBIT PAB 4475
PC712-100UL ANTI-P53 BINDING PROTEIN 1 (AB-1) RB PAB 4622
PC713-100UG ANTI-ALDEHYDE DEHYDROGENASE 1 GOAT PAB 4900
PC715-100UG ANTI-ATF-4 GOAT PAB 4900
PC716-100UG ANTI-DDAH1 GOAT PAB 4900
PC717-100UG ANTI-DDAH2 GOAT PAB 4900
PC718-100UG ANTI-DDB1 GOAT PAB 6124
PC720-100UG ANTI-GADD34 GOAT PAB 4900
PC723-100UG ANTI-KAISO GOAT PAB 4900
PC724-100UG ANTI-LIVIN GOAT PAB 4900
PC727-100UG ANTI-SPHINGOSINE KINASE 1 GOAT PAB 4973
PC729-25UL ANTI-B-AMYLOID (ASP-1) (FCA18) RB PAB 3408
PC730-100UL ANTI-IDE, N-TERMINAL (97-273) RABBIT PAB 4680
PC732-100UL PD ANTI-BRCA1 (PSER1524) RABBIT PAB 5192
PC733-100UL ANTI-CDC25A RABBIT PAB 4695
PC737-100UL ANTI-SMC1 RABBIT PAB 4695
PC742-100UL ANTI-AURORA-A RABBIT PAB 4695
PC746-25UL PD ANTI-GLYCOGEN SYNTHASE (PSER) RB PAB 4124
PC78-100UG ANTI-FAS LIGAND (AB-1) RABBIT PAB 3876
PC85-100UG ANTI-ATM (AB-1) RABBIT PAB 3876
PC86-100UG ANTI-TRKB RABBIT PAB 3832
PC89-100UG ANTI-BCL-XS (AB-1) RABBIT PAB 3832
PC91-100UG ANTI-RAF1 (AB-2) RABBIT PAB 3832
PC92L-100UG ANTI-RARA (AB-1) RABBIT PAB 3832
PC94L-100UG ANTI-MT1-MMP (160-173) (AB-2) RABBIT PAB 3832
PC99-100UL ANTI-FGF-R (AB-2) RABBIT PAB 3832
PF017-1UG TGF BETA 2 RECOMBINANT HUMAN PROTEIN 4246
PF019-3UG TIMP-1, RECOMBINANT, HUMAN 2959
PF021-3UG TIMP-2, HUMAN, RECOMBINANT 2959
PF023-5UG MMP-2, ACTIVE, HUMAN, RECOMBINANT 4714
PF024-5UG MMP-9, HUMAN, RECOMBINANT (83 KDA) 4714
PF032-1EA ANNEXIN V FITC APOPTOSIS DETECTION KIT 4869
PF033-10UG FAS LIGAND, HUMAN, RECOMBINANT 7042
PF036-1EA ANNEXIN V BIOTIN APOPTOSIS DETECTION KIT 5399
PF037-10UG MMP-2, PROENZYME, HUMAN, RECOMBINANT 7805
PF038-10UG MMP-9, PROENZYME, HUMAN, RECOMBINANT 4714
PF039-10UG GDNF, RAT RECOMBINANT 4864
PF048-50UG HEREGULIN, HUMAN, RECOMBINANT 6036
PF050-50UG PLEIOTROPHIN, HUMAN, RECOMBINANT 6286
PF059-.08ML KLENOW ENZYME 2340
PF060-.155ML TDT ENZYME 2435
PF063-10UG MMP-3, PROENZYME, HUMAN 4714
PF073-2UG TGF BETA 3 PROTEIN, HUMAN RECOMBINANT 6201
PF074-10UG VEGF165, HUMAN, RECOMBINANT 5583
PF078-50UG HEPARIN BINDING-EGF, HUMAN, RECOMBINANT 3778
PF082-50UG VEGF RECEPTOR 1 (FLT-1), HU., RECOMB 6586
PF088-10UG BAFF,HUMAN, RECOMBINANT 8457
PF092-5UG FAS LIGAND PLUS, HUMAN, RECOMBINANT 9393
PF113-5UG ADAMTS4, TRUNCATED, HIS-TAG, HU., RECOMB 5782
PF117-10UG MT5-MMP CATALYTIC DOMAIN, HIS-TAG, REC. 6649
PF118-5UG MMP-2, MOUSE CALVARIAE 2775
PF121-1MG A-SARCIN, ASPERGILLUS GIGANTEUS 3009
PF122-100UG CRMA, RECOMBINANT 9126
PF123-100UG 4-1BB/FC CHIMERA, HIS-TAG, HU., RECOMB 5549
PF124-20UG ADAM10, HIS-TAG, MOUSE, RECOMBINANT 6853
PF125-50UG BACE-1, HIS-TAG, HUMAN, RECOMBINANT 5148
PF126-50UG BCL-2, C-TERMINAL TRUNCATED, RECOMB., 6652
PF129-50UG BID, HUMAN, RECOMBINANT, E. COLI 6652
PF130-50UG BID, CASPASE-8-CLEAVED, HU., RECOMB, 6652
PF132-100UG DECORIN, HU., RECOMB, S. FRUGIPERDA 5494
PF133-10UG TACE, HIS-TAG, RECOMBINANT PROTEIN 5867
PF135-25UG IGFBP-3, HUMAN, RECOMBINANT 6118
PF136-100UG SMAC/DIABLO, HUMAN, RECOMBINANT  7053
PF138-25UG RESISTIN, HUMAN, RECOMBINANT, E. COLI 5332
PF139-25UG RESISTIN, MURINE, RECOMBINANT, E. COLI 5332
PF140-5UG MMP-9, HU., RECOMB, ACTIVE (67 KDA) 4597
PH01-100UG ANTI-PTPASE 1B (AB-1) MOUSE MAB (FG6-1G) 4124
PH02-100UG ANTI-PTPASE 1B (AB-2) MOUSE MAB (AE4-2J) 4124
PH03L-100UG ANTI-PTP, T CELL (AB-1) MO MAB (CF4-1D) 4066
PH04-100UG ANTI-PP2CG MOUSE MAB (7-53) 4066
PH06-100UL ANTI-PTP-PEST MOUSE MAB (AG 25 2-82) 4066
PK04-200UG RAYTIDE EL SUBSTRATE 1889
PK1000-100UL PHOSDETECTANTI-MEK5(PSER311,PTHR315)RABP 4315
PK1001-100UL PD ANTI-PLK1 (PTHR 210) RABBIT PAB 4315
PK1004-50UL ANTI-JAK1 RABBIT PAB 2311
PK1006-50UL PD ANTI-C-ABL (PTHR735) RABBIT PAB 3335
PK1007-50UL PD ANTI-MAPKAPK-2(PTHR222) RABBIT PAB 3335
PK1008-50UL PD ANTI-PDGF RECEPTOR-B(PTYR751) RB PAB 3335
PK1010-50UL PD ANTI-SYK (PTYR525/526) RABBIT PAB 3335
PK1011-50UL PD ANTI-C-KIT (PTYR719) RABBIT PAB 3335
PK1013-50UL PD ANTI-C-ABL (PTYR245) RABBIT PAB 3335
PK1014-50UL ANTI-PKC (A, B, G) MOUSE MAB (M110) 3232
PK1015-50UG PD ANTI-P70S6K (PTHR389) RABBIT PAB 3335
PK1016-50UG ANTI-HEPSIN RABBIT PAB 2121
PK1017-50UG ANTI-CORIN RABBIT PAB 2121
PK1018-100UL ANTI-PKG, C-TER (657-671) RABBIT PAB 3883
PK1109-50UL PD ANTI-SRC FAMILY (PTYR416) RABBIT PAB 3379
PK1111-100UG ANTI-GSK-3 BETA RABBIT PAB 3883
PK11-50UG ANTI-AURORA-A MOUSE MAB (35C1) 2354
PK1158-50UL ANTI-RHEB (AB-2) RABBIT PAB 4022
PK1159-50UL ANTI-RICTOR RABBIT PAB 4022
PK1200-50UG ANTI-RHEB (AB-1) RABBIT PAB 3291
PK1201-50UG ANTI-ROCK-1 MOUSE MAB 2852
PK1202-50UL PHOSPHODETECTANTI-4EBP1(PTHR70)RABBITPAB 3297
PK1203-50UL PHOSPHODETECT ANTI-AKT PTHR450 RABBITPAB 3794
PK1204-50UL PHOSPHODETECTANTI-AMPKA(PTHR172)RABBITPA 3297
PK1205-50UL PHOSPHODETECTANTI-AMPKB(PSER108)RABBITPA 3794
PK1206-50UL PHOSPHODETECTANTI-4E-BP1(PTHR37/46)RABBI 3297
PK1300-100UG ANTI-CERK RABBIT PAB RABBIT PAB 4461
PP10-100UG C-FOS PEPTIDE 995
PP51-100UG BAX PEPTIDE 995
PP52-100UG BCL-2 PEPTIDE 995
PP69-.25MG B-AMYLOID PEPTIDE (1-42), HUMAN 3377
PS1001-100UL PD ANTI-ATF2 (PSER490/498) RABBIT PAB 5192
PS1002-100UL PD ANTI-SYNAPTOTAGMIN (PSER309) RB PAB 5192
PS1003-100UL PD ANTI-IFNAR1 (PSER535/539) RABBIT PAB 5192
PS1004-100UL PD ANTI-TAO2 (PSER181) RABBIT PAB 5192
PS1005-100UL PD ANTI-DARPP32 (PTHR75) RABBIT PAB 5192
PS1006-100UL PD ANTI-SYNAPTOTAGMIN (PTHR202) RB PAB 5192
PS1007-100UL PD ANTI-C-MET (PTYR1230/1234/1235)RB PAB 4900
PS1008-100UL PD ANTI-FAK (PTYR861) RABBIT PAB 4900
PS1009-100UL PD ANTI-IR/IGF1R(PY1158/1162/1163)RB PAB 4900
PS1010-10T PD ANTI-IRS1 (PTYR612) RABBIT PAB 4900
PS1011-10T PD ANTI-PRAS40 (PTHR246) RABBIT PAB 4973
PS1012-10T PD ANTI-VEGFR2 (PTYR1214) RABBIT PAB 4900
PS1013-10T PD ANTI-VEGFR2 (PTYR1054/1059) RB PAB 4900
PS1014-100UL PD ANTI-JAK2 (PTYR1007/1008) RABBIT PAB 4900
PS1017-100UL PD ANTI-EIF-2B EPSILON (PSER539) RB PAB 4900
PS1019-100UL PD ANTI-JNK1&2 (PTHR183/PTYR185) RB PAB 4973
PS1020-50UG PD ANTI-MTOR (PSER2448) RABBIT PAB 3379
PS1021-1KIT PHOSPHODETECT STAT ANTIBODY SAMPLER KIT 7181
PS1022-50UL PHOSPHODETECT ANTI-MARCKS (PSER152/156) 2296
PS1023-50UL PHOSPHODETECT ANTI-ANTI-SMAD3 (PSER423/4 3628
PS1024-50UL PHOSPHODETECT ANTI-ANTI-SMAD1/5 (PSER463 3628
PS1089-100UL PHOSPHODETECTANTI-RHOA(PSER188)RABBITPAB 4461
PT01L-200UG PD ANTI-TYROSINE (AB-1) MO MAB (1G2) 1551
QIA07-1EA P53 ELISA KIT (PANTROPIC) 10413
QIA10-1EA C-ERBB2/C-NEU RAPID FORMAT ELISA KIT 12698
QIA108-1KIT CASPASE-7 IMMUNOASSAY/ACTIVITY KIT 10642
QIA112-1KIT GALECTIN-3 ELISA KIT 10238
QIA113-1KIT CASPASE-8 DETECTION KIT (FITC-IETD-FMK) 8930
QIA114-1KIT CASPASE-8 DETECTION KIT (RED-IETD-FMK) 8930
QIA115-1KIT CASPASE-9 DETECTION KIT (FITC-LEHD-FMK) 8930
QIA116-1KIT CASPASE-9 DETECTION KIT (RED-LEHD-FMK) 8930
QIA117-1KIT SENESCENCE DETECTION KIT 5450
QIA119-1KIT HSP27 ELISA KIT 9147
QIA120-1KIT CALPAIN ACTIVITY ASSAY KIT, FLUOROGENIC 9955
QIA125-1KIT UROKINASE ACTIVITY ASSAY KIT 6250
QIA127-1KIT RAPID CELL PROLIFERATION KIT 3787
QIA128-1KIT ULTRASENSITIVE CELL PROLIFERATION ASSAY 3764
QIA129-1KIT CELL INVASION ASSAY KIT (24-WELL) 6442
QIA130-1KIT MMP-13 ELISA KIT 9943
QIA20-1EA CELL DEATH DETECTION (NMP) ELISA KIT 9077
QIA21-1EA KLENOW FRAGEL DNA FRAGMENT. DETECT. KIT 7141
QIA23-1EA BCL-2 ELISA KIT 12668
QIA27-1EA FAS LIGAND ELISA KIT 8991
QIA29-1EA CATHEPSIN D, RAPID FORMAT ELISA KIT 8991
QIA33-1EA TDT FRAGEL TM DNA FRAGMENT. DETECT. KIT 6489
QIA39-1EA FLUORESCEIN FRAGEL DNA FRAG. DETECT. KIT 4869
QIA40-1EA TIMP-2 ELISA KIT 9251
QIA51-1EA VEGF ELISA KIT, HUMAN 10515
QIA52-1EA VEGF ELISA KIT, MOUSE 10647
QIA53-1EA P53 AUTOANTIBODY ELISA PLUS KIT 10028
QIA54-1EA TIMP-1 ELISA KIT 8040
QIA55-1EA MMP-1 ELISA 8332
QIA56-1EA MMP-9 ELISA KIT 8350
QIA58-1000TEST BRDU CELL PROLIFERATION ASSAY 9545
QIA58-200TEST BRDU CELL PROLIFERATION ASSAY 5219
QIA59-1EA PCNA ELISA KIT 8991
QIA61-1EA TGF-ALPHA ELISA KIT 13077
QIA63-1EA MMP-2 ELISA KIT 8177
QIA64-1EA BASIC FGF ELISA KIT-REPLACES CAT# QIA43 9736
QIA70-1KIT CASPASE-3 ACTIVITY ASSAY 6739
QIA71-1KIT CASPASE-8 ACTIVITY ASSAY 6844
QIA72-1KIT CASPASE-9 ACTIVITY ASSAY 8070
QIA73-1EA MMP-3 ELISA KIT 12621
QIA74-1EA CYTOCHROME C ELISA KIT 9790
QIA76-100TEST LIVE/DEAD DOUBLE STAINING KIT 4785
QIA87-1KIT CYTOCHROME C RELEASE APOPTOSIS ASSAY KIT 8930
QIA88-1KIT PROTEOEXTRACT CYTOSOL/MITOCHONDRIA FRACT 5564
QIA89-1KIT GLUTATHIONE APOPTOSIS DETECTION KIT 8586
QIA90-1KIT CASPASE DETECTION KIT(FITC-VAD-FMK) 8930
QIA91-1KIT CASPASE-3 DETECTION KIT (FITC-DEVD-FMK) 8586
QIA92-1KIT CASPASE DETECTION KIT (RED-VAD-FMK) 7892
QIA93-1KIT CASPASE-3 DETECTION KIT (RED-DEVD-FMK) 8586
QIA94-1KIT CATHEPSIN L ELISA KIT 10012
QIA95-1KIT PHOSPHODETECT(TM) EGF RECEPTOR ELISA KIT 10642
QIA96-1KIT PMN ELASTASE/ALPHA1-PI COMPLEX ELISA KIT 9009
QIA97-1KIT CU/ZN SUPEROXIDE DISMUTASE ELISA 9268
QIA99-1KIT SOLUBLE T-PA ELISA KIT 9901
SC1000-50UG ANTI-NANOG RABBIT PAB 2311
SC1002-100UG ANTI-SOX2 MOUSE MAB (245610) 4490
ST1000-100UG ANTI-GLUTATHIONE PEROXIDASE MO MAB (347) 4973
ST1001-100UL PD ANTI-MEK1/2 (PTHR292) RABBIT PAB 5075
ST1002-100UL PD ANTI-MEK1/2 (PTHR386) RABBIT PAB 5075
ST1008-10T PD ANTI-FAK (PSER722) RABBIT PAB 5017
ST1010-10T PD ANTI-FAK (PTYR407) RABBIT PAB 5017
ST1011-10T PD ANTI-FAK (PTYR577) RABBIT PAB 5017
ST1013-10T PD ANTI-GSK-3A/B (PTYR279/216) RB PAB 4900
ST1015-10T PD ANTI-MEK1 (PSER298) RABBIT PAB 5017
ST1018-10T PD ANTI-PAK1/2/3 (PTHR423) RABBIT PAB 5017
ST1020-10T PD ANTI-PHOSPHOLIPASE CG1 PTYR783 RB PAB 4900
ST1021-10T PD ANTI-PYK2 (PTYR580) RABBIT PAB 5017
ST1023-10T PD ANTI-PYK2 (PTYR579/580) RABBIT PAB 5017
ST1025-100UL ANTI-RAGE GOAT PAB 4051
ST1027-50UL ANTI-ACETYLATED LYSINE RABBIT PAB 3554
ST1029-1SET PD ANTI-FOS (PSER374) MOUSE MAB (34E4) 5017
ST1032-100UL ANTI-TRB3 RABBIT PAB 4475
ST1033-50UG ANTI-SHC RABBIT PAB 3496
ST1036-50UL ANTI-PDK1 RABBIT PAB 2604
ST1037-50UG ANTI-SLAP-2, HUMAN (RABBIT) 2428
ST1041-50UL ANTI-RKIP RABBIT PAB 2370
ST1042-50UG ANTI-PKD2 RABBIT PAB 2706
ST1043-100UG ANTI-CSN3 RABBIT PAB 4622
ST1044-100UG ANTI-CSN4 RABBIT PAB 4622
ST1045-100UG ANTI-JAB1/CSN5 RABBIT PAB 4622
ST1046-100UG ANTI-P70S6 KINASE RABBIT PAB 4900
ST1047-100UL ANTI-NFKB (P65) MOUSE MAB (2A12A7) 3832
ST1048-100UG ANTI-RAPTOR RABBIT PAB 4900
ST1049-100UL ANTI-20S PROTEASOME A1-3,5-7-SUB MO MAB 4724
ST1050-100UL ANTI-20SPROTEASOME A3-SUB MO MAB(MCP257) 4724
ST1051-100UL ANTI-20SPROTEASOME A5-SUB MO MAB(MCP196) 4724
ST1052-100UL ANTI-20SPROTEASOME A7-SUB MO MAB (MCP72) 4724
ST1053-100UL ANTI-20S PROTEASOME CORE SUBUNITS RB PAB 4783
ST1054-100UL ANTI-20SPROTEASOME B1-SUB MO MAB(MCP421) 4724
ST1055-100UL ANTI-20SPROTEASOME B3-SUB MO MAB(MCP102) 4724
ST1056-100UL ANTI-20S PROTEASOME B4-SUBUNIT RB PAB 4724
ST1057-100UL ANTI-20S PROTEASOME B5I-SUBUNIT RB PAB 4724
ST1059-100UL ANTI-19S REG ATPASE SUB RPT4 MO MAB 4724
ST1060-100UL ANTI-19S REG NON-ATPASE SUBRPN10 MO MAB 4724
ST1061-50UG ANTI-SIN1 RABBIT PAB 3883
ST1063-50UG ANTI-RAPTOR RABBIT PAB 4022
ST1069-50UG PD ANTI-PAXILLIN (PSER178) RABBIT PAB 3934
ST1070-50UG ANTI-TIAM1 RABBIT PAB 2370
ST1071-50UG ANTI-CYCLOPHILIN A, HUMAN, HUCAL FAB 2370
ST1072-50UL PD ANTI-PTEN (PSER380) RABBIT PAB 2881
ST1073-50UL PD ANTI-PDK1 (PSER241) RABBIT PAB 2881
ST1074-50UL PD ANTI-MKK7 (PSER271,THR275) RABBIT PAB 2881
ST1075-50UL PD ANTI-ATF-2 (PTHR71) RABBIT PAB 2881
ST1076-50UL PD ANTI-RAF (PSER259) RABBIT PAB 2881
ST1077-50UL ANTI-P38 MAP KINASE D RABBIT PAB 2194
ST1078-50UL PD ANTI-IKKA/B (PSER176/180) RABBIT PAB 2881
ST1079-50UL PD ANTI-IKKG/NEMO (PSER376) RABBIT PAB 2881
ST1080-50UL ANTI-ERK5 RABBIT PAB 2370
ST1081-50UL PD ANTI-SHIP1 (PTYR1020) RABBIT PAB 2881
ST1082-50UL PD ANTI-SHP-2 (PTYR542) RABBIT PAB 2881
ST1083-50UL ANTI-SHP-2 RABBIT PAB 2370
ST1084-50UL ANTI-TUBERIN/TSC2 (PTHR1462) RABBIT PAB 2881
ST1086-50UG ANTI-TYRO 3 RABBIT PAB 2370
ST1087-50UG PD ANTI-WASP (PSER483/484) RABBIT PAB 2881
ST1088-1SET ANTI-AKT, PH DOMAIN MOUSE MAB (SKB1) 4549
ST1089-50UG ANTI-AMPKA-2 RABBIT PAB 2370
ST1090-50UG ANTI-PKD3 RABBIT PAB 2311
ST1091-50UG ANTI-PIM1 RABBIT PAB 2311
ST1092-50UG ANTI-LKB1 RABBIT PAB 2223
ST1093-50UG ANTI-STK10 RABBIT PAB 2311
ST1094-50UG ANTI-FOXO1A RABBIT PAB 2311
ST1095-100UG ANTI-NNOS (NOS1) (1414-1434) RABBIT PAB 4900
ST1096-100UL ANTI-CD40 (258-277) RABBIT PAB 4695
ST1097-50UG ANTI-PAK5 RABBIT PAB 2311
ST1098-50UL ANTI-PAN TORC (1-42) RABBIT PAB 2311
ST1099-50UL ANTI-TORC2 (454-607) RABBIT PAB 2355
ST1100-50UG ANTI-CRM1 RABBIT PAB 2311
ST1101-50UG ANTI-RANBP1 RABBIT PAB 2311
ST1102-50UG ANTI-KPNBETA1 RABBIT PAB 2311
ST1104-50UL ANTI-SMAD5 RABBIT PAB 2600
ST1105-50UL ANTI-STAT5 RABBIT PAB 2311
ST1106-50UL PD ANTI-STAT2 (PTYR690) RABBIT PAB 3335
ST1107-50UL ANTI-LYN RABBIT PAB 2311
ST1108-50UG ANTI-PAK6 RABBIT PAB 2311
ST1109-50UL ANTI-CALDESMON MOUSE MAB (TD107) 2311
ST1110-100UL ANTI-MAP 2 MOUSE MAB (SMI-52) 4417
ST1111-100UL ANTI-NESTIN MOUSE MAB (2C13B9) 3891
ST1112-100UL ANTI-RAP1GAP RABBIT PAB 4534
ST1113-50UG ANTI-WASP RABBIT PAB 2238
ST1114-50UL ANTI-KPNALPHA2 RABBIT PAB 2311
ST1115-50UL ANTI-PDK1 (1-556) RABBIT PAB 2311
ST1116-50UG ANTI-MAVS RABBIT PAB 2311
ST1117-50UG ANTI-NESTIN RABBIT PAB 2311
ST1118-50UG ANTI-ESPL1/SEPARASE RABBIT PAB 2165
ST1119-50UG ANTI-NOD2/CARD15 RABBIT PAB 2165
ST1120-50UG ANTI-IDE/INSULYSIN RABBIT PAB 2311
ST1121-50UL ANTI-ASC RABBIT PAB 2311
ST1122-50UG ANTI-RICTOR  MOUSE MAB (2C8) 2311
ST1123-50UL ANTI-PHLPP1 RABBIT PAB 2311
ST1124-50UL ANTI-NALP1 RABBIT PAB 4315
ST1125-50UL ANTI-NALP2 RABBIT PAB 4315
ST1126-50UL ANTI-NALP4 RABBIT PAB 4315
ST1127-50UL ANTI-NALP12 RABBIT PAB 4315
ST1130-50UG ANTI-SENP1 RABBIT PAB 2852
ST1131-50UG ANTI-SENP2 RABBIT PAB 2852
ST1132-50UG ANTI-SENP5 RABBIT PAB 2852
ST1133-50UG ANTI-DNMT1 MOUSE MAB (60B1220.1) 2852
ST1134-50UG ANTI-DNMT-2 MOUSE MAB (102B1259.2) 2852
ST1135-50UG ANTI-SUMO2/3 RABBIT PAB 2852
ST1136-50UG ANTI-TSC2 RABBIT PAB 3291
ST1137-50UG ANTI-FOXP3 MOUSE MAB (3G3) 2852
ST1139-50UG ANTI-HDAC11 RABBIT PAB 2852
ST1140-100UG ANTI-DVL3 RABBIT PAB 3883
ST1141-100UG ANTI-DKK2 MOUSE MAB 3883
ST1142-100UG ANTI-WNT-2 RABBIT PAB 3883
ST1143-100UG ANTI-WNT-4 RABBIT PAB 3883
ST1145-50UL ANTI-UBC3 RABBIT PAB 3883
ST1149-50UL ANTI-SENP2 RABBIT PAB 2706
ST1150-100UG ANTI-CDC23 RABBIT PAB 3583
ST1151-100UG ANTI-GRAIL RABBIT PAB 3583
ST1152-50UL ANTI-SENP1 RABBIT PAB 2706
ST1153-50UL ANTI-SENP6 RABBIT PAB 2706
ST1154-50UL ANTI-SENP7 RABBIT PAB 2706
ST1155-100UG ANTI-UBCH5 RABBIT PAB 3583
ST1156-100UG ANTI-UBCH6E RABBIT PAB 3583
ST1157-100UG ANTI-UBCH6 RABBIT PAB 3583
ST1200-100UG ANTI-UBIQUITIN MOUSE MAB 3883
ST1202-1SET ANTI-PGC-1 ALPHA MOUSE MAB (4C1.3) 5833
ST1500-100UL PHOSPHODETECT ANTI-RAF-1(PSER301)RABPAB 4315
ST1501-50UL PRAS40 RABBIT PAB 4170
ST1502-50UG RNF-5 RABBIT PAB 4170
ST1503-50UL PROTOR2 RABBIT PAB 4170
ST1504-50UL TCTP RABBIT PAB 4170
ST1505-100UG ANTI-WIPI1 MOUSE MAB (3C1) 5760
ST1506-100UG ANTI-SAA1 MOUSE MAB (3C11-2C1) 5760
ST1507-100UG ANTI-AKR1B10 MOUSE MAB (1A6) 5760
ST1508-100UG ANTI-PCK1 MOUSE MAB (3E4) 5760
ST1509-100UG ANTI-PCK2 RABBIT PAB 5760
ST1510-100UG ANTI-FGF1 RABBIT PAB 5760
ST1511-100UG ANTI-FGF1 MOUSE MAB (3F5) 5760
ST1512-100UG ANTI-EDN3 RABBIT PAB 5760
ST1513-100UG EDN3 MONOCLONAL ANTIBODY (M01), CLONE2A4 5760
ST1514-100UG ANTI-FKBP1A MOUSE MAB (1E5-A12) 5760
ST1515-100UG ANTI-CAMK1 MOUSE MAB (3G1) 5760
ST1516-100UG ANTI-GK RABBIT PAB 5760
ST1517-100UG ANTI-PIP5K3 MOUSE MAB (6C7) 5760
ST1518-50UG ANTI-PIK3C3 MOUSE PAB 5760
ST1519-100UG ANTI-ERN1 MOUSE MAB (8D12) 5760
ST1520-100UG ANTI-PRKACG MOUSE MAB (2F3) 5760
ST1521-100UG ANTI-ULK1 MOUSE MAB 5760
ST1522-100UG ANTI-HIPK2 MOUSE MAB (4F4) 5760
ST1523-100UG ANTI-CLN3 MOUSE MAB (1G10) 5760
ST1524-100UG ANTI-CLN3 RABBIT PAB 5760
ST1525-50UG ANTI-ATG16L1 MOUSE PAB 5760
ST1526-100UG ANTI-ATG3 MOUSE MAB (1F7) 5760
ST1527-50UG ANTI-FABP1 MOUSE MAB (5F7) 5760
ST1528-100UG ANTI-FABP3 MOUSE MAB (4F6-1D6) 5760
ST1529-100UG ANTI-HTT MOUSE MAB (3F1) 5760
ST1530-100UL ANTI-MB RABBIT PAB 5760
ST1531-100UG ANTI-ADH4 MOUSE MAB (1D2) 5760
ST1532-100UG ANTI-ALDH2 RABBIT PAB 5760
ST1533-100UG ANTI-ALDH2 MOUSE MAB (1E5) 5760
ST1534-100UG ANTI-NQO1 MOUSE MAB (1E3-A6) 5760
ST1535-100UG ANTI-NQO1 RABBIT PAB 5760
ST1536-50UG ANTI-HSD17B1 MOUSE MAB (2E5) 5760
ST1537-100UG ANTI-PCSK1 MOUSE MAB (3D2) 5760
ST1538-50UG ANTI-ATG4C MOUSE PAB 5760
ST1539-100UG ANTI-PEPD MOUSE MAB (1D5-H3) 5760
ST1540-100UG ANTI-UBE2D3 MOUSE MAB (4C1-1E3) 5760
ST1541-100UG ANTI-TPP1 MOUSE MAB (3B1) 5760
ST1542-100UG ANTI-GZMM MOUSE MAB (4D11) 5760
ST1543-100UG ANTI-GHR MOUSE MAB (3A12) 5760
ST1546-100UG ANTI-CBS MOUSE MAB (3E1) 5760
ST1547-100UG ANTI-CPS1 MOUSE MAB (8H8) 5760
ST1548-100UG ANTI-CTH MOUSE MAB (S51) 5760
ST1549-50UG ANTI-FASN MOUSE MAB (3F2-1F3) 5760
ST1550-100UG ANTI-SHMT1 MOUSE MAB (4F9) 5760
ST1551-100UG GGT1 MONOCLONAL ANTIBODY (M01), CLONE1F9 5760
ST1552-100UG ANTI-NPC1 MOUSE MAB (4H2) 5760
ST1553-100UG ANTI-VCP MOUSE MAB (4A8) 5760
ST1554-100UG ANTI-AGER MOUSE MAB (1C1) 3980
ST1555-100UG ANTI-AHSG RABBIT PAB 3980
ST1556-100UG ANTI-ALAD RABBIT PAB 3980
ST1557-100UG ANTI-ALDH1A1 MOUSE MAB (1A2) 3980
ST1558-100UG ANTI-ALOX12 MOUSE MAB (2D10) 3980
ST1559-100UG ANTI-ATP7B MOUSE MAB (3E10) 3980
ST1560-100UG ANTI-BZRP MOUSE MAB (3D8-B2) 3980
ST1561-100UG ANTI-CLN3 RABBIT PAB 3980
ST1562-100UG ANTI-COPB MOUSE MAB (3E10) 3980
ST1563-100UG ANTI-CYP1B1 MOUSE MAB (2F8) 3980
ST1564-100UG ANTI-CYP19A1 RABBIT PAB 3980
ST1565-100UG ANTI-DAPK1 MOUSE MAB (2E7) 3980
ST1566-100UG ANTI-DDIT3 MOUSE MAB (2G3) 3980
ST1567-100UG ANTI-DEFA1 MOUSE MAB (3G9) 3980
ST1568-100UG ANTI-DEFB4 MOUSE MAB (4C4) 3980
ST1569-200UL ANTI-DSCR1 MOUSE MAB (1G7) 3980
ST1570-100UG ANTI-EPOR RABBIT PAB 3980
ST1571-100UG ANTI-FCGR2A MOUSE MAB (3E8) 3980
ST1572-100UG ANTI-FKBP1B MOUSE MAB (4H5-1B6) 3980
ST1573-100UG ANTI-GGCX MOUSE MAB (5A9) 3980
ST1574-100UG ANTI-GRN RABBIT PAB 3980
ST1575-100UG ANTI-HFE MOUSE MAB (1G12) 3980
ST1576-100UG ANTI-NRG1 RABBIT PAB 3980
ST1577-100UG ANTI-HSD3B2 RABBIT PAB 3980
ST1578-100UG ANTI-IMPDH2 MOUSE MAB (1E12-B6) 3980
ST1579-100UG ANTI-FADS1 MOUSE MAB (2D9) 3980
ST1580-100UG ANTI-LRP5 MOUSE MAB (1E9) 3980
ST1581-100UG ANTI-MAOA RABBIT PAB 3980
ST1582-100UG ANTI-MAOB RABBIT PAB 3980
ST1583-100UG ANTI-MFGE8 MOUSE MAB (1E7) 3980
ST1584-100UG ANTI-MTHFR MOUSE MAB (2H9) 3980
ST1585-100UG ANTI-OGG1 RABBIT PAB 3980
ST1586-100UG ANTI-OLR1 MOUSE MAB (2C9) 3980
ST1587-100UG ANTI-OPA1 RABBIT PAB 3980
ST1588-100UG ANTI-PKLR RABBIT PAB 3980
ST1589-200UL ANTI-PKM2 MOUSE MAB (5D2-3B3) 3980
ST1590-100UG ANTI-PLA2G4A MOUSE MAB (10G5) 3980
ST1591-100UG ANTI-PLIN RABBIT PAB 3980
ST1592-100UG ANTI-PLIN MOUSE MAB (4G1) 3980
ST1593-100UG ANTI-SLC11A1 MOUSE MAB (2G2) 3980
ST1594-100UL ANTI-SMN2 RABBIT PAB 3980
ST1595-100UG ANTI-SSR1 MOUSE MAB (1A12) 3980
ST1596-100UG ANTI-CDKL5 MOUSE MAB (1D9) 3980
ST1597-100UG ANTI-TGM1 RABBIT PAB 3980
ST1598-100UG ANTI-YWHAG MOUSE MAB (6A10) 3980
ST1599-100UG ANTI-PLA2G7 MOUSE MAB (5D1) 3980
ST1600-100UG ANTI-ADAM12 MOUSE MAB (1G3) 3980
ST1601-100UG ANTI-NR0B2 MOUSE MAB (1A11) 3980
ST1602-100UG ANTI-APLN MOUSE MAB (2A1-2D5) 3980
ST1603-100UG ANTI-LIPG MOUSE MAB (1E11) 3980
ST1604-100UG ANTI-ADAMTS1 MOUSE MAB (1B8) 3980
ST1605-100UG ANTI-PDIA4 MOUSE MAB (4C6) 3980
ST1606-100UG ANTI-ABCG1 MOUSE MAB (2E11) 3980
ST1607-100UG ANTI-HERPUD1 MOUSE MAB (2G7) 3980
ST1608-100UG ANTI-TANK RABBIT PAB 3980
ST1609-100UL ANTI-MAP3K7IP1 RABBIT PAB 3980
ST1610-100UG ANTI-MAP3K7IP1 MOUSE MAB (2A12) 3980
ST1611-100UG ANTI-HPSE MOUSE MAB (4D7) 3980
ST1612-100UG ANTI-TXNDC4 RABBIT PAB 3980
ST1613-100UG ANTI-TXNDC4 MOUSE MAB (3C7) 3980
ST1614-100UL ANTI-MAP3K7IP2 RABBIT PAB 3980
ST1615-100UG ANTI-FGF21 MOUSE MAB (2F11) 3980
ST1616-100UG ANTI-BSCL2 MOUSE MAB (1G4) 3980
ST1617-100UG ANTI-SPG3A MOUSE MAB (1B9) 3980
ST1618-100UL ANTI-TAOK3 RABBIT PAB 3980
ST1619-100UG ANTI-TAOK3 MOUSE MAB (4C12) 3980
ST1620-100UG ANTI-PNPLA2 MOUSE MAB (2H1) 3980
ST1621-50UG ANTI-FKBP10 MOUSE MAB (1C6) 3980
ST1622-100UG ANTI-LEPRE1 MOUSE MAB (3C7) 3980
ST1623-100UG ANTI-SYVN1 RABBIT PAB 3980
ST1624-50UG ANTI-AKAP9 MOUSE MAB (1A6) 5760
ST1625-100UG ANTI-SMAD7 MOUSE MAB (4E1) 3980
ST1626-100UG ANTI-GRB7 RABBIT PAB 3980
ST1627-100UG ANTI-RECK RABBIT PAB 3980
ST1628-100UL ANTI-SKP2 RABBIT PAB 3980
ST1629-100UG ANTI-GNA13 MOUSE MAB (6F6-B5) 3519
ST1630-100UG ANTI-FGF8 MOUSE MAB (2A10) 3980
ST1631-100UG ANTI-BMP7 MOUSE MAB (M1-F8) 3519
ST1632-100UL ANTI-BMP7 RABBIT PAB 3980
ST1633-100UG ANTI-NOV MOUSE MAB (3C2) 3980
ST1634-100UG ANTI-NOV RABBIT PAB 3980
ST1635-100UG ANTI-ECGF1 RABBIT PAB 3980
ST1636-200UL ANTI-FST MOUSE MAB (1G4) 3519
ST1637-100UG ANTI-ITGA7 MOUSE MAB (8G2) 3980
ST1638-100UG ANTI-CDK7 MOUSE MAB (1G5) 3519
ST1639-100UG ANTI-CDK7 RABBIT PAB 3980
ST1640-100UG ANTI-CSNK1E MOUSE MAB (2E1) 3519
ST1641-100UG ANTI-MAP4K4 MOUSE MAB (4A5) 3980
ST1642-100UG ANTI-MAP4K5 MOUSE MAB (3H3) 3980
ST1643-100UG ANTI-PDK2 MOUSE MAB (2G1) 3980
ST1644-50UG ANTI-AURKB MOUSE MAB (6A6) 3980
ST1645-100UG ANTI-CKM MOUSE MAB (1E3) 3980
ST1646-100UG ANTI-CKM RABBIT PAB 3980
ST1647-100UG ANTI-PGK1 MOUSE MAB (2H4) 3980
ST1648-100UG ANTI-DMPK MOUSE MAB (2F7) 3980
ST1649-100UG ANTI-DMPK RABBIT PAB 3980
ST1650-100UG ANTI-DYRK1A MOUSE MAB (7D10) 3980
ST1651-100UG ANTI-GRK6 MOUSE MAB (2C3) 3980
ST1652-100UG ANTI-MVK MOUSE MAB (2C5) 3980
ST1653-100UG ANTI-RIOK3 MOUSE MAB (3G11) 3980
ST1654-100UG ANTI-RIOK3 RABBIT PAB 3980
ST1655-100UG ANTI-CAMKK1 MOUSE MAB (1F6) 3980
ST1656-100UG ANTI-MOS RABBIT PAB 3980
ST1657-100UG ANTI-MYLK RABBIT PAB 3980
ST1658-100UG ANTI-PBK MOUSE MAB (3A11) 3980
ST1659-50UG ANTI-YARS MOUSE MAB (2F3) 3519
ST1660-100UG ANTI-MSLN MOUSE MAB (1A10) 3980
ST1661-100UG ANTI-MSLN RABBIT PAB 3980
ST1662-100UG ANTI-BCL9 MOUSE MAB (2D4) 3980
ST1663-100UG ANTI-GMPS MOUSE MAB (1D10) 3980
ST1664-100UG ANTI-GMPS RABBIT PAB 3980
ST1665-100UG ANTI-GSR MOUSE MAB (6B4) 3980
ST1666-100UG ANTI-GSR RABBIT PAB 3980
ST1667-100UG ANTI-TFF2 MOUSE MAB (2A10) 3980
ST1668-50UG ANTI-TFF1 MOUSE MAB (M2) 3980
ST1669-100UG ANTI-PDCD11 MOUSE MAB (3E12) 3980
ST1670-100UG ANTI-TAL2 MOUSE MAB (1G6) 3980
ST1671-100UG ANTI-TMEPAI MOUSE MAB (2A12) 3980
ST1672-100UG ANTI-DPYD MOUSE MAB (7D4) 3980
ST1673-100UG ANTI-AFP MOUSE MAB (1G7) 3980
ST1674-100UL ANTI-AFP RABBIT PAB 3980
ST1675-100UG ANTI-ADAMTS13 MOUSE MAB (4F12) 3980
ST1676-100UG ANTI-TMPRSS2 MOUSE MAB (2F4) 3980
ST1677-100UG ANTI-ABCC6 MOUSE MAB (1E6) 3980
ST1678-100UG ANTI-SLC3A2 RABBIT PAB 3980
ST1679-100UG ANTI-EVI1 MOUSE MAB (6A9) 3519
ST1680-100UG ANTI-FGFR2 MOUSE MAB (1G3) 3519
ST1681-200UL ANTI-SIGIRR MOUSE MAB (3H8-2G3) 3519
ST1682-100UG ANTI-COPS2 MOUSE MAB (4B12) 3519
ST1683-100UG ANTI-FKBP4 RABBIT PAB 3519
ST1684-100UG ANTI-MAG MOUSE MAB (3C7) 3519
ST1685-100UG ANTI-TRPA1 MOUSE MAB (6G8) 3519
ST1686-100UL ANTI-AIDA RABBIT PAB 3519
ST1687-100UG ANTI-FLJ12806 MOUSE MAB (2E6-1C11) 3519
ST1688-50UG ANTI-HEXA MOUSE MAB (2C3) 3980
ST1689-100UG ANTI-FCN2 RABBIT PAB 3519
ST1690-100UG ANTI-MEFV MOUSE MAB (4E6) 3519
ST1691-100UG ANTI-ICOS RABBIT PAB 3519
ST1692-50UG ANTI-ICOS MOUSE MAB (1G1) 3519
ST1693-100UG ANTI-RARRES2 RABBIT PAB 3519
ST1694-100UG ANTI-BOLL RABBIT PAB 3519
ST1695-100UG ANTI-BOLL MOUSE MAB (5B8) 3519
ST1696-100UG ANTI-FRZB RABBIT PAB 3519
ST1697-100UG ANTI-FRZB MOUSE MAB (1H8) 3519
ST1698-100UG ANTI-PDLIM7 MOUSE MAB (2D6) 3519
ST1699-100UG ANTI-NDE1 MOUSE MAB (2G11-1C11) 3519
ST1700-100UG ANTI-MIB1 MOUSE MAB (2A9) 3519
ST1701-100UG ANTI-CAV3 MOUSE MAB (1G11) 3519
ST1702-100UG ANTI-RAG2 MOUSE MAB (2G8) 3519
ST1703-100UG ANTI-DLL1 MOUSE MAB (4F8) 3519
ST1704-100UG ANTI-TOMM22 MOUSE MAB (4G4) 3519
ST1705-100UG ANTI-TOMM20 MOUSE MAB (4F3) 3519
ST1706-100UG ANTI-MFN2 MOUSE MAB (4H8) 3980
ST1707-100UG ANTI-CDC37 MOUSE MAB (3C7) 3519
ST1708-100UG ANTI-TRIM5 MOUSE MAB (2A6) 3519
ST1709-100UG ANTI-SKP1A MOUSE MAB (1H8) 3519
ST1710-100UG ANTI-DFHR RABBIT PAB 3519
ST1711-100UG ANTI-DFHR MOUSE MAB (2B10) 3519
ST1712-100UG ANTI-TTR MOUSE MAB (4D8) 3519
ST1713-100UG ANTI-SERPING1 MOUSE MAB (3F4-1D9) 3519
ST1714-100UG ANTI-PAPPA MOUSE MAB (1G3) 3519
ST1715-100UG ANTI-C1S RABBIT PAB 3519
ST1716-100UG ANTI-IF MOUSE MAB (1B3) 3519
ST1717-100UG ANTI-BMPR2 MOUSE MAB (4A2) 3519
ST1718-100UG ANTI-SMO MOUSE MAB (1D9) 3519
WA01-2UG P21 H-RAS GLY-12 WESTERN BLOT STANDARD 1856
WB36-10LANE A431 CELL PELLET (10 LANES) 1856
WB37-10LANE HELA CELL PELLET (10 LANES) 1806
WB39-10LANE MCF7 CELL PELLET (10 LANES) 1856
WB43-10LANE JURKAT CELL PELLET (10 LANES) 1856
WB57-175GM BLOT-QUICKBLOCKER(TM) REAGENT 920
WB59-100ML WESTERN-RE-PROBE(TM) REAGENT 2307
WB64-200UG HELA CELL NUCLEAR EXTRACT 2357
 

产品相关关键字: merck代理 calbiochem代理 novagen
 如果你对merck 2012年价格表感兴趣,想了解更详细的产品信息,填写下表直接与厂家联系:

留言框

  • 产品:

  • 留言内容:

  • 您的单位:

  • 您的姓名:

  • 联系电话:

  • 常用邮箱:

  • 详细地址:

  • 省份:

  • 验证码:

    请输入计算结果(填写阿拉伯数字),如:三加四=7
 相关同类产品:
Protein Ark 特约代理  BioChain 中国授权代理  D12492research diets 高脂饲料  N-1019 N-1014TriLink BioTechnologies --核酸修饰专家  CalBioreagents产品介绍  BPS Bioscience产品列表  boston biochem产品目录  Smartox Biotechnology特约代理  signalchemlifesciences特约代理  SynQuest Laboratories 产品信息 
 
返回首页 | 关于我们 | 联系我们
上海起发实验试剂有限公司 版权所有 总访问量:1720597 地址:上海浦东川沙镇川沙路6619号上海起发实验试剂有限公司 邮编:201203
电话:021-50724187 021-50724961 传真:021-50724961 手机:15921799099 联系人:杨经理 邮箱:fige007@163.com
GoogleSitemap 网址:www.qfbio.com 技术支持:化工仪器网 管理登陆 ICP备案号:沪ICP备11048721号-2
全国免费电话:
4006551678
电话:021-50724187
  直接客户
  经销商
  北京
  物流
  湖南
  广东

化工仪器网

推荐收藏该企业网站